LXL04_037733 | RubberDandelionOmics

Gene overview

LXL04_037733

Reference: OH-1004 Chr: Chr09 Coordinates: 19674330-19675842 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1362 bp · LXL04_037733|LXL04_037733|OH1004|cDNA

ATGGCGGACGAGAAAGAGGCGAAGGAAGTGGTTGTTGCGAAGACCGATGATAAGGATACGAAGAAGAGCAAGAAGAAGAGCGGTATTTTCTCTCGAATTTGGAATGCTGTGTTTAGGTCGCGAAGCGATGATTTTGAGAAGAGGTTGCAGTATATATCTAAAGAAGAGGCTACGCTTATTTCGCGAATGAAGAGGCGATCTCTGAGATGGAGGCGAACGGCGAGGAATTTAATCATCTTCTCCGTTGTCCTTGAGGTAAT...

CDS

Download CDS FASTA

1362 bp · LXL04_037733|LXL04_037733|OH1004|CDS

ATGGCGGACGAGAAAGAGGCGAAGGAAGTGGTTGTTGCGAAGACCGATGATAAGGATACGAAGAAGAGCAAGAAGAAGAGCGGTATTTTCTCTCGAATTTGGAATGCTGTGTTTAGGTCGCGAAGCGATGATTTTGAGAAGAGGTTGCAGTATATATCTAAAGAAGAGGCTACGCTTATTTCGCGAATGAAGAGGCGATCTCTGAGATGGAGGCGAACGGCGAGGAATTTAATCATCTTCTCCGTTGTCCTTGAGGTAAT...

Protein

Download Protein FASTA

453 aa · LXL04_037733|LXL04_037733|OH1004|PROTEIN

MADEKEAKEVVVAKTDDKDTKKSKKKSGIFSRIWNAVFRSRSDDFEKRLQYISKEEATLISRMKRRSLRWRRTARNLIIFSVVLEVIPLIININPNFYIDVCLLPGSGLIEIHFVLAQIVAVGYAIMTTRTANMEWRMRSLRVLPMFLLPALSFALHYGLLSFTRFGKSYILLIPINPKFSQPSSPSIFGIIGDRRDQKALEKLRAERQAKIDELKERTNYYITQQLIQKYDPDPAAKAAAASVLASKLGADSGLKMFLG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037733`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037733

Location Chr09:19674330-19675842 (-)

Description Similar to At2g24330: Uncharacterized protein At2g24330

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g24330`	Uncharacterized protein At2g24330.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037733 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007029 endoplasmic reticulum organization Biological Process

GO:0071784 endoplasmic reticulum cisternal network assembly Biological Process

GO:0071786 endoplasmic reticulum tubular network organization Biological Process

GO:0071788 endoplasmic reticulum tubular network maintenance Biological Process

GO:1903373 positive regulation of endoplasmic reticulum tubular network organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0071782 endoplasmic reticulum tubular network Cellular Component

GO:0097225 sperm midpiece Cellular Component

KEGG gene cross-reference

ath:AT2G24330

hsa:80856

mmu:69605

pon:100173134

tru:100125769

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.477

Rank 1 · LXL04_037733 · OH-1004

Golgi apparatus0.220

Rank 2 · LXL04_037733 · OH-1004

Nucleus0.194

Rank 3 · LXL04_037733 · OH-1004

Cytoplasm0.122

Rank 4 · LXL04_037733 · OH-1004

Cell membrane0.099

Rank 5 · LXL04_037733 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10058.15Zn_ribbon_10337-387 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037733	`PF10058.15`	Zn_ribbon_10	337	387	5.1e-19	68.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZQ34`	Arabidopsis thaliana	Uncharacterized protein At2g24330	51.263%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card