RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G332360
Reference: TK1151 Chr: Chr04 Coordinates: 83858435-83865378 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3578 bp · TkA04G332360|TK1151|cDNA

TTAGACTGTTTCCTGCATTCCCATTCTGAGAAAACCGAATATGGCGGTCCACTCCCATATTCCCGAAAACCCAACGGTGGTCGCTCTAGCCAAACCAACAATGATACCTGCACAGATCGGGACGAAAATCAATCCACCAGTCAACGAATTTCAGCCATGATCGGAGGAAACTCTTGTAATCGCCATGATCCACACAGTAAAATCAACCCACAATTGAACTCACTCGCCGGACTGATTAGTGATTACCGTCGAAGACAAGG...

CDS

Download CDS FASTA

1794 bp · TkA04G332360|TK1151|CDS

ATGCTCTCCTTAAAACCATCTCCGAACCTGGTTTATGGAAATCATTATCATCTCTACAAGAGTTTGAGAAAAAAATATCTAGAGCTAACAAAGGGCGCCGCGGATAACTACCACCATTCATGGTGGAAAAGGCACGGGGTAGTCCTCGATGGCGAAATCGCCTCCGTCTGCTTCAAAAACGGTAACCACGATCTAGCTGCAAAATCATACGAGAAAGTCTGCGCTCTTTACTCCGGTGAAGGATGGCACGATTTGTTAGC...

Protein

Download Protein FASTA

598 aa · TkA04G332360|TK1151|PROTEIN

MLSLKPSPNLVYGNHYHLYKSLRKKYLELTKGAADNYHHSWWKRHGVVLDGEIASVCFKNGNHDLAAKSYEKVCALYSGEGWHDLLADVLPNLAECQKILNDRAGYLSSCVRLLSLDKGLFLTKERQAFQSEVVRLAHSEMEDPVPLDVSALITFSGNSGPPMELCDGDPGSLNVTLWCDFPDEIALESLSLTLTATNNADDCVKAIRSGDVTILKPGRNTITLSLPPQRPGSYVLGVLTGQIGHLRFRSHGFSRGGPAD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G332360
TK1151 IDTkA04G332360
OH-1004 IDLXL04_037613
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)97.800
Protein coverage (%)TK1151 97.157 / OH-1004 49.204
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G332360
LocationChr04:83858435-83865378 (+)
DescriptionSimilar to TRS130: Trafficking protein particle complex II-specific subunit 130 homolog
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g54440 Specific subunit of the TRAPP II complex, a highly conserved vesicle tethering complex that is required for the proper transport of proteins in post-Golgi trafficking pathways to the growing cell plate in mitotic active cells.
A putative TRAPPII tethering factor is required for cell plate assembly during cytokinesis in Arabidopsis.2010 · DOI: 10.1111/j.1469-8137.2010.03331.x
A specific role for Arabidopsis TRAPPII in post-Golgi trafficking that is crucial for cytokinesis and cell polarity.2011 · DOI: 10.1111/j.1365-313x.2011.04681.x

Rice

Reference gene IDPossible functionPapers / DOI
Os12g0554400 Specific subunit of the TRAPP II complex, a highly conserved vesicle tethering complex that is required for the proper transport of proteins in post-Golgi trafficking pathways to the growing cell plate in mitotic active cells. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_037613 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000911 cytokinesis by cell plate formation Biological Process
GO:0000919 cell plate assembly Biological Process
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process
GO:0006891 intra-Golgi vesicle-mediated transport Biological Process
GO:0006901 vesicle coating Biological Process
GO:0034498 early endosome to Golgi transport Biological Process
GO:0099022 vesicle tethering Biological Process
GO:0005737 cytoplasm Cellular Component
GO:0005769 early endosome Cellular Component
GO:0005802 trans-Golgi network Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT5G54440
ddi:DDB_G0273209
ddi:DDB_G0273719
dosa:Os12g0554400
hsa:7109
mmu:216131
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.431
Rank 1 · TkA04G332360 · TK1151
Nucleus0.372
Rank 2 · TkA04G332360 · TK1151
Endoplasmic reticulum0.152
Rank 3 · TkA04G332360 · TK1151
Golgi apparatus0.119
Rank 4 · TkA04G332360 · TK1151
Cell membrane0.086
Rank 5 · TkA04G332360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30303TRAPPC10-Trs130_NTS21-137 aa
PF11817Foie-gras_143-115 aa
PF13424TPR_1252-102 aa
PF00515TPR_153-76 aa
PF13181TPR_853-76 aa
PF07719TPR_254-77 aa
PF28381Ig_TRS130145-279 aa
PF30300Ig_TRS130_1st180-225 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G332360PF30303TRAPPC10-Trs130_NTS211379.7e-71239.6
TkA04G332360PF11817Foie-gras_1431150.0004720.6
TkA04G332360PF13424TPR_12521020.01616.1
TkA04G332360PF00515TPR_153760.08213.5
TkA04G332360PF13181TPR_853760.2912.1
TkA04G332360PF07719TPR_254770.1413.1
TkA04G332360PF28381Ig_TRS1301452797.1e-63211.1
TkA04G332360PF30300Ig_TRS130_1st1802250.1513.0
TkA04G332360PF30304Ig_TRAPPC10_1st1922481.8e-0525.5
TkA04G332360PF30304Ig_TRAPPC10_1st4474771.8e-0525.5
TkA04G332360PF30300Ig_TRS130_1st5375510.1513.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
F4K0C4Arabidopsis thalianasp|F4K0C4|TR130_ARATH Trafficking protein particle complex II-specific subunit 130 homolog63.400%Swiss-ProtHigh
Q2QNU0Oryza sativa subsp. japonicasp|Q2QNU0|TR130_ORYSJ Trafficking protein particle complex II-specific subunit 130 homolog60.200%Swiss-ProtHigh

JBrowse

View in Genome Browser