LXL04_037613 | RubberDandelionOmics

Gene overview

LXL04_037613

Reference: OH-1004 Chr: Chr09 Coordinates: 15813531-15820715 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3582 bp · LXL04_037613|LXL04_037613|OH1004|cDNA

ATGGAGAATTTTTTAGCTCAATTTCAGTCCATCAAAAACTCTTGTAATCGCCTCGTCATTGCAGTTGACGATGTGAATGATGTGTGGCCTCTTGTCAAGGAAGGATTTGAGAAACGGCTTCCATTCAAAAAAGCTATATTGAACAACAAAACCCGTAATCCTGTAACTGTACATAATCTACCAGCTGAATTCATCCTAGCATCAGATCTAAAGGTCCGAAGTCGCTTCATTCCAGATCAACCATTGTTCTGGTTTCGAGA...

CDS

Download CDS FASTA

3582 bp · LXL04_037613|LXL04_037613|OH1004|CDS

ATGGAGAATTTTTTAGCTCAATTTCAGTCCATCAAAAACTCTTGTAATCGCCTCGTCATTGCAGTTGACGATGTGAATGATGTGTGGCCTCTTGTCAAGGAAGGATTTGAGAAACGGCTTCCATTCAAAAAAGCTATATTGAACAACAAAACCCGTAATCCTGTAACTGTACATAATCTACCAGCTGAATTCATCCTAGCATCAGATCTAAAGGTCCGAAGTCGCTTCATTCCAGATCAACCATTGTTCTGGTTTCGAGA...

Protein

Download Protein FASTA

1193 aa · LXL04_037613|LXL04_037613|OH1004|PROTEIN

MENFLAQFQSIKNSCNRLVIAVDDVNDVWPLVKEGFEKRLPFKKAILNNKTRNPVTVHNLPAEFILASDLKVRSRFIPDQPLFWFREPYATVVLITCEDLDEFKTILKPRLKLTLQNDEKQWFIVFVSKAARHNDQAYKMAQKVYGRVEVDFNSRKRERCCKYDLHGPEGTFWEELEFKIMECIRNSLDRRIQFYEDEIRKLSELRFMPIWSFCNFFMLKESLAFMFEMAHLNEESLREYDELELCYLETVKNPGRLREF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037613`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037613

Location Chr09:15813531-15820715 (-)

Description Similar to TRS130: Trafficking protein particle complex II-specific subunit 130 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54440`	Specific subunit of the TRAPP II complex, a highly conserved vesicle tethering complex that is required for the proper transport of proteins in post-Golgi trafficking pathways to the growing cell plate in mitotic active cells.	A putative TRAPPII tethering factor is required for cell plate assembly during cytokinesis in Arabidopsis.2010 · DOI: 10.1111/j.1469-8137.2010.03331.x A specific role for Arabidopsis TRAPPII in post-Golgi trafficking that is crucial for cytokinesis and cell polarity.2011 · DOI: 10.1111/j.1365-313x.2011.04681.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0554400`	Specific subunit of the TRAPP II complex, a highly conserved vesicle tethering complex that is required for the proper transport of proteins in post-Golgi trafficking pathways to the growing cell plate in mitotic active cells.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037613 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0000919 cell plate assembly Biological Process

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0006891 intra-Golgi vesicle-mediated transport Biological Process

GO:0006901 vesicle coating Biological Process

GO:0034498 early endosome to Golgi transport Biological Process

GO:0099022 vesicle tethering Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005769 early endosome Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT5G54440

ddi:DDB_G0273209

ddi:DDB_G0273719

dosa:Os12g0554400

hsa:7109

mmu:216131

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.506

Rank 1 · LXL04_037613 · OH-1004

Nucleus0.330

Rank 2 · LXL04_037613 · OH-1004

Golgi apparatus0.151

Rank 3 · LXL04_037613 · OH-1004

Endoplasmic reticulum0.095

Rank 4 · LXL04_037613 · OH-1004

Cell membrane0.092

Rank 5 · LXL04_037613 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23036.3TRAPPC10_1st16-205 aa

PF30303.1TRAPPC10-Trs130_NTS312-484 aa

PF30303.1TRAPPC10-Trs130_NTS484-633 aa

PF28381.1Ig_TRS130641-775 aa

PF12584.14TRAPPC10_C1081-1161 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037613	`PF23036.3`	TRAPPC10_1st	16	205	1.6e-18	67.4
LXL04_037613	`PF30303.1`	TRAPPC10-Trs130_NTS	312	484	3.3e-178	593.2
LXL04_037613	`PF30303.1`	TRAPPC10-Trs130_NTS	484	633	3.3e-178	593.2
LXL04_037613	`PF28381.1`	Ig_TRS130	641	775	2.3e-62	209.4
LXL04_037613	`PF12584.14`	TRAPPC10_C	1081	1161	2.7e-09	37.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4K0C4`	Arabidopsis thaliana	Trafficking protein particle complex II-specific subunit 130 homolog	64.184%	Swiss-Prot	strong database homology
`Q2QNU0`	Oryza sativa subsp. japonica	Trafficking protein particle complex II-specific subunit 130 homolog	62.620%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card