RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G326910
Reference: TK1151 Chr: Chr04 Coordinates: 82621327-82623284 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

879 bp · TkA04G326910|TK1151|cDNA

ATGCGAGGTGAAGAAGAAAGATGGCACCGGCGGGTAAATGGAGCTCGGGCTCAGCGTGACGACGACACCGTAGGAGTTTGGGTTCAGAAAGATGAGCGGCTTCGCGGGACTCGCACACGGTCAGACAGATGCGATAAGGTCACGAAACTATGCGATTTGGGTATCGACAAAACCGTGTGTTCAGTTTCTTGGTCACAACAAGGAACAACTCTCGCAGTCGGTACCAGCAATGGAGAAGTCCAGATATGGGACGTGTTTGG...

CDS

Download CDS FASTA

879 bp · TkA04G326910|TK1151|CDS

ATGCGAGGTGAAGAAGAAAGATGGCACCGGCGGGTAAATGGAGCTCGGGCTCAGCGTGACGACGACACCGTAGGAGTTTGGGTTCAGAAAGATGAGCGGCTTCGCGGGACTCGCACACGGTCAGACAGATGCGATAAGGTCACGAAACTATGCGATTTGGGTATCGACAAAACCGTGTGTTCAGTTTCTTGGTCACAACAAGGAACAACTCTCGCAGTCGGTACCAGCAATGGAGAAGTCCAGATATGGGACGTGTTTGG...

Protein

Download Protein FASTA

292 aa · TkA04G326910|TK1151|PROTEIN

MRGEEERWHRRVNGARAQRDDDTVGVWVQKDERLRGTRTRSDRCDKVTKLCDLGIDKTVCSVSWSQQGTTLAVGTSNGEVQIWDVFGCKKLRSMEDFLNLFDLEVLLLNNNGFTGAIPTEAYLSNPLLCHLNAEISEFNESREKELPLIQEVDIKIKELRQMISALNNQQMSLKAAFRKKKDAVKEMDEKISSAEFALVQSAQENASLRSKIVQSPVKLQRALEEKKAVLIESKNAERESMQSFQIINFVISRAYRVTDK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G326910
TK1151 IDTkA04G326910
OH-1004 IDLXL04_039697
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)94.500
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G326910
LocationChr04:82621327-82623284 (-)
DescriptionSimilar to NUF2: Kinetochore protein NUF2 homolog
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g61000 Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity to ensure proper cell division.
MUN (MERISTEM UNSTRUCTURED), encoding a SPC24 homolog of NDC80 kinetochore complex, affects development through cell division in Arabidopsis thaliana.2018 · DOI: 10.1111/tpj.13823
At4g11920 Activator protein that regulates the ubiquitin ligase activity and substrate specificity of the anaphase promoting complex/cyclosome (APC/C).
Arabidopsis anaphase-promoting complexes: multiple activators and wide range of substrates might keep APC perpetually busy.2005 · DOI: 10.4161/cc.4.8.1856
APC/C-CCS52A complexes control meristem maintenance in the Arabidopsis root.2009 · DOI: 10.1073/pnas.0901193106
At4g22910 Activator protein that regulates the ubiquitin ligase activity and substrate specificity of the anaphase promoting complex/cyclosome (APC/C).
Arabidopsis anaphase-promoting complexes: multiple activators and wide range of substrates might keep APC perpetually busy.2005 · DOI: 10.4161/cc.4.8.1856
FZR2/CCS52A1 expression is a determinant of endoreduplication and cell expansion in Arabidopsis.2009 · DOI: 10.1104/pp.108.132449
APC/C-CCS52A complexes control meristem maintenance in the Arabidopsis root.2009 · DOI: 10.1073/pnas.0901193106
At5g13840 Activator protein that regulates the ubiquitin ligase activity and substrate specificity of the anaphase promoting complex/cyclosome (APC/C).
Arabidopsis anaphase-promoting complexes: multiple activators and wide range of substrates might keep APC perpetually busy.2005 · DOI: 10.4161/cc.4.8.1856

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_039697 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000070 mitotic sister chromatid segregation Biological Process
GO:0007052 mitotic spindle organization Biological Process
GO:0008361 regulation of cell size Biological Process
GO:0009624 response to nematode Biological Process
GO:0009825 multidimensional cell growth Biological Process
GO:0009877 nodulation Biological Process
GO:0010091 trichome branching Biological Process
GO:0010342 endosperm cellularization Biological Process
GO:0010492 maintenance of shoot apical meristem identity Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0030154 cell differentiation Biological Process
GO:0031145 anaphase-promoting complex-dependent catabolic process Biological Process
KEGG gene cross-reference
ath:AT1G61000
ath:AT4G11920
ath:AT4G22910
ath:AT5G13840
mtr:25493638
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.484
Rank 1 · TkA04G326910 · TK1151
Cytoplasm0.394
Rank 2 · TkA04G326910 · TK1151
Cell membrane0.093
Rank 3 · TkA04G326910 · TK1151
Mitochondrion0.063
Rank 4 · TkA04G326910 · TK1151
Endoplasmic reticulum0.056
Rank 5 · TkA04G326910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24105Beta-prop_CAF1B_HIR119-96 aa
PF24814WD40_Prp1920-48 aa
PF25175Beta-prop_WDR520-95 aa
PF25047Beta-prop_TEP1_2nd20-86 aa
PF24817WD40_WDHD1_1st44-94 aa
PF24807WD40_CDC20-Fz45-95 aa
PF12894ANAPC4_WD4046-91 aa
PF24814WD40_Prp1946-114 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G326910PF24105Beta-prop_CAF1B_HIR119960.04213.5
TkA04G326910PF24814WD40_Prp1920480.0003420.5
TkA04G326910PF25175Beta-prop_WDR520950.001318.8
TkA04G326910PF25047Beta-prop_TEP1_2nd20860.0812.8
TkA04G326910PF24817WD40_WDHD1_1st44941.7e-0524.9
TkA04G326910PF24807WD40_CDC20-Fz45957e-1039.4
TkA04G326910PF12894ANAPC4_WD4046913.4e-0524.7
TkA04G326910PF24814WD40_Prp19461140.0003420.5
TkA04G326910PF23389Beta-prop_WDR19_1st48900.0004420.1
TkA04G326910PF23098Beta-prop_NOL10_N52850.001418.5
TkA04G326910PF23414Beta-prop_EML_252850.007416.4
TkA04G326910PF23775Beta-prop_RIG_2nd53920.003417.6
TkA04G326910PF23381Beta-prop_IFT122_1st56871.3e-0525.4
TkA04G326910PF25174Beta-prop_THOC356890.0005319.8
TkA04G326910PF24805EIF3I56950.2611.1
TkA04G326910PF00400WD4057840.0006520.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8RXJ0Arabidopsis thalianasp|Q8RXJ0|NUF2_ARATH Kinetochore protein NUF2 homolog55.900%Swiss-ProtLow
Q8VZS9Arabidopsis thalianasp|Q8VZS9|FZR1_ARATH Protein FIZZY-RELATED 170.000%Swiss-ProtLow
Q8L3Z8Arabidopsis thalianasp|Q8L3Z8|FZR2_ARATH Protein FIZZY-RELATED 266.000%Swiss-ProtLow
Q8LPL5Arabidopsis thalianasp|Q8LPL5|FZR3_ARATH Protein FIZZY-RELATED 355.100%Swiss-ProtLow

JBrowse

View in Genome Browser