LXL04_039697 | RubberDandelionOmics

Gene overview

LXL04_039697

Reference: OH-1004 Chr: JAJTUU010000028.1 Coordinates: 81967-83924 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

930 bp · LXL04_039697|LXL04_039697|OH1004|cDNA

ATGCGaggtgaagaagaaagatggcaccGGCGGGTAAATGGAGCTCGGGCTCAGCGTGACGACGACACCGTAGGAGTTTGGGTTCAGAAAGATGAACGGCTTCGCGGGACTCGCACACGGTCAGACAGATGCGATAAGGTGGTTTTGATTTGTAGTTCTCCTCAACTACTGTATGGAATGCGTCTAGTCACGAAACTATGCGATTTGGGTATCGACAAAACCGTGTGTTCAGTTTCTTGGTCACAACAAGGAACAACTCT...

CDS

Download CDS FASTA

930 bp · LXL04_039697|LXL04_039697|OH1004|CDS

ATGCGAGGTGAAGAAGAAAGATGGCACCGGCGGGTAAATGGAGCTCGGGCTCAGCGTGACGACGACACCGTAGGAGTTTGGGTTCAGAAAGATGAACGGCTTCGCGGGACTCGCACACGGTCAGACAGATGCGATAAGGTGGTTTTGATTTGTAGTTCTCCTCAACTACTGTATGGAATGCGTCTAGTCACGAAACTATGCGATTTGGGTATCGACAAAACCGTGTGTTCAGTTTCTTGGTCACAACAAGGAACAACTCT...

Protein

Download Protein FASTA

309 aa · LXL04_039697|LXL04_039697|OH1004|PROTEIN

MRGEEERWHRRVNGARAQRDDDTVGVWVQKDERLRGTRTRSDRCDKVVLICSSPQLLYGMRLVTKLCDLGIDKTVCSVSWSQQGTTLAVGTSNGEVQIWDVFGCKKLRSMEDFLNLFDLEVLLLNNNGFTGAIPTEVAYLSNPLLCHLNAEISEFNESREKELPLIQEVDIKIKELRQMISALNNQQMSLKAAFRKKKDAVKEMDEKISSAEFALVQSAQENASLRSKIVQSPVKLQRALEEKKAVLIESKNAERESMQS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039697`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039697

Location JAJTUU010000028.1:81967-83924 (+)

Description Similar to NUF2: Kinetochore protein NUF2 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61000`	Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity to ensure proper cell division.	MUN (MERISTEM UNSTRUCTURED), encoding a SPC24 homolog of NDC80 kinetochore complex, affects development through cell division in Arabidopsis thaliana.2018 · DOI: 10.1111/tpj.13823
`At4g11920`	Activator protein that regulates the ubiquitin ligase activity and substrate specificity of the anaphase promoting complex/cyclosome (APC/C).	Arabidopsis anaphase-promoting complexes: multiple activators and wide range of substrates might keep APC perpetually busy.2005 · DOI: 10.4161/cc.4.8.1856 APC/C-CCS52A complexes control meristem maintenance in the Arabidopsis root.2009 · DOI: 10.1073/pnas.0901193106
`At4g22910`	Activator protein that regulates the ubiquitin ligase activity and substrate specificity of the anaphase promoting complex/cyclosome (APC/C).	Arabidopsis anaphase-promoting complexes: multiple activators and wide range of substrates might keep APC perpetually busy.2005 · DOI: 10.4161/cc.4.8.1856 FZR2/CCS52A1 expression is a determinant of endoreduplication and cell expansion in Arabidopsis.2009 · DOI: 10.1104/pp.108.132449 APC/C-CCS52A complexes control meristem maintenance in the Arabidopsis root.2009 · DOI: 10.1073/pnas.0901193106
`At5g13840`	Activator protein that regulates the ubiquitin ligase activity and substrate specificity of the anaphase promoting complex/cyclosome (APC/C).	Arabidopsis anaphase-promoting complexes: multiple activators and wide range of substrates might keep APC perpetually busy.2005 · DOI: 10.4161/cc.4.8.1856

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039697 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000070 mitotic sister chromatid segregation Biological Process

GO:0007052 mitotic spindle organization Biological Process

GO:0008361 regulation of cell size Biological Process

GO:0009624 response to nematode Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0009877 nodulation Biological Process

GO:0010091 trichome branching Biological Process

GO:0010342 endosperm cellularization Biological Process

GO:0010492 maintenance of shoot apical meristem identity Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031145 anaphase-promoting complex-dependent catabolic process Biological Process

KEGG gene cross-reference

ath:AT1G61000

ath:AT4G11920

ath:AT4G22910

ath:AT5G13840

mtr:25493638

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.459

Rank 1 · LXL04_039697 · OH-1004

Cytoplasm0.408

Rank 2 · LXL04_039697 · OH-1004

Cell membrane0.097

Rank 3 · LXL04_039697 · OH-1004

Mitochondrion0.067

Rank 4 · LXL04_039697 · OH-1004

Endoplasmic reticulum0.060

Rank 5 · LXL04_039697 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24807.2WD40_CDC20-Fz63-111 aa

PF23381.2Beta-prop_IFT122_1st72-103 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039697	`PF24807.2`	WD40_CDC20-Fz	63	111	3.3e-09	37.2
LXL04_039697	`PF23381.2`	Beta-prop_IFT122_1st	72	103	1e-05	25.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXJ0`	Arabidopsis thaliana	Kinetochore protein NUF2 homolog	55.932%	Swiss-Prot	weak database homology
`Q8VZS9`	Arabidopsis thaliana	Protein FIZZY-RELATED 1	69.388%	Swiss-Prot	weak database homology
`Q8L3Z8`	Arabidopsis thaliana	Protein FIZZY-RELATED 2	65.306%	Swiss-Prot	weak database homology
`Q8LPL5`	Arabidopsis thaliana	Protein FIZZY-RELATED 3	54.167%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card