TkA04G326790 | RubberDandelionOmics

Gene overview

TkA04G326790

Reference: TK1151 Chr: Chr04 Coordinates: 82593802-82598174 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1436 bp · TkA04G326790|TK1151|cDNA

TCCGGGGGGAAACTTATAAAGTTTCAAACTTAGAAGAGCGAGATGTTAACAGACATAATACGAGGTCCATAATTTCATTTGTCAGGAAACGTCCATTTGAGTACAGAGGTACAAACAGAGCAACCATTAGAGACAGAGCTCAAGTTCCAGATACTTGCAAGACGAGCACCACAGTCTGAGAACGGACATCAAACAAACATTAAATTGCATTAAAAAACCATCAATTTGAAGTCAGATATCTTTATTTTCTATTCACTCCT...

CDS

Download CDS FASTA

777 bp · TkA04G326790|TK1151|CDS

ATGTCTATCGCCGATCACCGCCGTTCGCATTCAGATGGAAAACGGTGGCGATTATGTTCGTTTTGGCAATCTGGACCACCTTCTTCGTCGTTTTCGTCAACGCGGAATCTTCAAGTTCAGAGTCAGAAAAGCCACGAAAACGGTGTCGCAGCTAACGGTCGTCGTGCTTCCAACAAGGTATCGTCGGTGGCAAAATCGCTCCTACCAGCTAGGCGAAGACTCAGCTTGGATCCAGCGAACAACCTTTACTTCCCTTATGA...

Protein

Download Protein FASTA

258 aa · TkA04G326790|TK1151|PROTEIN

MSIADHRRSHSDGKRWRLCSFWQSGPPSSSFSSTRNLQVQSQKSHENGVAANGRRASNKVSSVAKSLLPARRRLSLDPANNLYFPYEPGKQVRSAVRIKNNSSSHVAFKFQTTAPKSSYMRPPGGTLAPGESIIATVFKFVEQPEKNEKQQSQRSKDKFKIMSLKVKEGTDYVPELFEEQKDDVVAERILRVIFLNAERPTPALEKLKHQLAEAEAELETRKKPQVETGPKAVEQGLVIDEWKERREKYLAKQQVAAV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G326790`
TK1151 ID	TkA04G326790
OH-1004 ID	LXL04_037578
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G326790

Location Chr04:82593802-82598174 (+)

Description Similar to PVA42: Vesicle-associated protein 4-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54110`	May play a role in vesicle trafficking.	No verified direct reference in this release
`At4g21450`	May play a role in vesicle trafficking.	No verified direct reference in this release
`At4g05060`	May play a role in vesicle trafficking.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037578 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006605 protein targeting Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0061817 endoplasmic reticulum-plasma membrane tethering Biological Process

GO:0090158 endoplasmic reticulum membrane organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0043495 protein-membrane adaptor activity Molecular Function

KEGG gene cross-reference

ath:AT2G45140

ath:AT4G00170

ath:AT4G05060

ath:AT4G21450

ath:AT5G54110

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.512

Rank 1 · TkA04G326790 · TK1151

Cytoplasm0.321

Rank 2 · TkA04G326790 · TK1151

Nucleus0.268

Rank 3 · TkA04G326790 · TK1151

Endoplasmic reticulum0.080

Rank 4 · TkA04G326790 · TK1151

Golgi apparatus0.059

Rank 5 · TkA04G326790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00635Motile_Sperm74-182 aa

PF16392DUF500188-137 aa

PF24507Ig_CFAP65_4th89-134 aa

PF22076Cep192_D689-153 aa

PF21310OCRL-like_ASH91-172 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G326790	`PF00635`	Motile_Sperm	74	182	7.5e-24	84.4
TkA04G326790	`PF16392`	DUF5001	88	137	0.014	16.0
TkA04G326790	`PF24507`	Ig_CFAP65_4th	89	134	0.0091	17.0
TkA04G326790	`PF22076`	Cep192_D6	89	153	0.047	14.6
TkA04G326790	`PF21310`	OCRL-like_ASH	91	172	0.19	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1ECE0`	Arabidopsis thaliana	sp\|Q1ECE0\|VAP41_ARATH Vesicle-associated protein 4-1	63.000%	Swiss-Prot	High
`Q8VYN2`	Arabidopsis thaliana	sp\|Q8VYN2\|VAP42_ARATH Vesicle-associated protein 4-2	75.900%	Swiss-Prot	High
`Q8LPQ7`	Arabidopsis thaliana	sp\|Q8LPQ7\|VAP43_ARATH Vesicle-associated protein 4-3	67.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card