LXL04_037578 | RubberDandelionOmics

Gene overview

LXL04_037578

Reference: OH-1004 Chr: Chr09 Coordinates: 15297269-15299533 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

777 bp · LXL04_037578|LXL04_037578|OH1004|cDNA

ATGTCTATCGCCGATCACCGCCGTTCGCATTCAGATGGAAAACGGTGGCGATTATGTTCGTTTTGGCAATCTGGACCACCTTCTTCGTCGTTTTCGTCAACGCGGAATCTTCAAGTTCAGAGTCAGAAAAGCCACGAAAACGGTGTCGCAGCTAACGGTCGTCGTGCTTCCAACAAGGTATCGTCGGTGGCAAAATCGCTCCTACCAGCTAGGCGAAGACTCAGCTTGGATCCAGCGAACAACCTTTACTTCCCTTATGA...

CDS

Download CDS FASTA

777 bp · LXL04_037578|LXL04_037578|OH1004|CDS

ATGTCTATCGCCGATCACCGCCGTTCGCATTCAGATGGAAAACGGTGGCGATTATGTTCGTTTTGGCAATCTGGACCACCTTCTTCGTCGTTTTCGTCAACGCGGAATCTTCAAGTTCAGAGTCAGAAAAGCCACGAAAACGGTGTCGCAGCTAACGGTCGTCGTGCTTCCAACAAGGTATCGTCGGTGGCAAAATCGCTCCTACCAGCTAGGCGAAGACTCAGCTTGGATCCAGCGAACAACCTTTACTTCCCTTATGA...

Protein

Download Protein FASTA

258 aa · LXL04_037578|LXL04_037578|OH1004|PROTEIN

MSIADHRRSHSDGKRWRLCSFWQSGPPSSSFSSTRNLQVQSQKSHENGVAANGRRASNKVSSVAKSLLPARRRLSLDPANNLYFPYEPGKQVRSAVRIKNNSSSHVAFKFQTTAPKSSYMRPPGGTLAPGESIIATVFKFVEQPEKNEKQQSQRSKDKFKIMSLKVKEGTDYVPELFEEQKDDVVAERILHVIFLNAERPTPALEKLKHQLAEAEAELETRKKPQVETGPKAVEQGLVIDEWKERREKYLAKQQVAAM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037578`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037578

Location Chr09:15297269-15299533 (+)

Description Similar to PVA42: Vesicle-associated protein 4-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g21450`	May play a role in vesicle trafficking.	No verified direct reference in this release
`At5g54110`	May play a role in vesicle trafficking.	No verified direct reference in this release
`At4g05060`	May play a role in vesicle trafficking.	No verified direct reference in this release
`At4g00170`	May play a role in vesicle trafficking.	No verified direct reference in this release
`At2g45140`	Vesicle-associated protein that binds the oxysterol-binding protein ORP3A and allows its targeting to the ER.	The targeting of the oxysterol-binding protein ORP3a to the endoplasmic reticulum relies on the plant VAP33 homolog PVA12.2009 · DOI: 10.1111/j.1365-313x.2009.03815.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037578 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006605 protein targeting Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0061817 endoplasmic reticulum-plasma membrane tethering Biological Process

GO:0090158 endoplasmic reticulum membrane organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0043495 protein-membrane adaptor activity Molecular Function

KEGG gene cross-reference

ath:AT2G45140

ath:AT4G00170

ath:AT4G05060

ath:AT4G21450

ath:AT5G54110

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.508

Rank 1 · LXL04_037578 · OH-1004

Cytoplasm0.322

Rank 2 · LXL04_037578 · OH-1004

Nucleus0.266

Rank 3 · LXL04_037578 · OH-1004

Endoplasmic reticulum0.081

Rank 4 · LXL04_037578 · OH-1004

Golgi apparatus0.061

Rank 5 · LXL04_037578 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00635.33Motile_Sperm74-182 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037578	`PF00635.33`	Motile_Sperm	74	182	7.6e-24	84.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYN2`	Arabidopsis thaliana	Vesicle-associated protein 4-2	71.564%	Swiss-Prot	strong database homology
`Q1ECE0`	Arabidopsis thaliana	Vesicle-associated protein 4-1	62.214%	Swiss-Prot	strong database homology
`Q8LPQ7`	Arabidopsis thaliana	Vesicle-associated protein 4-3	67.347%	Swiss-Prot	strong database homology
`Q84WW5`	Arabidopsis thaliana	Vesicle-associated protein 1-3	32.031%	Swiss-Prot	weak database homology
`Q9SHC8`	Arabidopsis thaliana	Vesicle-associated protein 1-2	31.061%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card