TkA04G314650 | RubberDandelionOmics

Gene overview

TkA04G314650

Reference: TK1151 Chr: Chr04 Coordinates: 79307113-79309082 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1200 bp · TkA04G314650|TK1151|cDNA

TTCAAAAAAGTATAAAACTCTAAAATAAAAAACAAAGTCTGCTAGATGACGCTGAACCACTCTCTAGTGGACGAATAATAAAAACAAATCTACAAAAGAACCCCAACACAGCAACACCAATCAACCAATTATTCCCCTCCATTTTCCATTTTCTCTTTCATTTCTCCACCATAACACCCAAACCCCACTTGTGTTCTTCCTTTTTCACCCACAACCCTCACCGGAAAATCTCCAATTGTTTAAATTCCGGCAATGGTCTC...

CDS

Download CDS FASTA

756 bp · TkA04G314650|TK1151|CDS

ATGGTCTCTCCGGAACCCACGAATTGGATCTACGAGTACGGGTTGATTGATGAAATTGCAGTACCTGATGGAAACTACACCGTTCCTGTTTCCGGATTCAGCTGGCCGATTCACGCAACGACCGTGAACAACAACGGTTCGTCGTCGAACCCTAGTTTGGATCTCGATGGCTCGATCATGGATTCAGACAGCCATAATAATGACTCCAGATCGAAAAAACGATTTATAAACGAAGATTGTCACTTTGATAGGGGAAGATC...

Protein

Download Protein FASTA

251 aa · TkA04G314650|TK1151|PROTEIN

MVSPEPTNWIYEYGLIDEIAVPDGNYTVPVSGFSWPIHATTVNNNGSSSNPSLDLDGSIMDSDSHNNDSRSKKRFINEDCHFDRGRSESCSGTSTKACREKLRRDKLNDKFLELASILEPGRPPKIDKSAILVDAVRMVTQLRKEAQKLKDSSSDLQEKIKELKTEKNELRDEKQRLKIEKEKLEQQVNTMNAQPPSFMPHHPPAIPTYGGHAIGNKLVPIMSYPGMAMWQFMPPAAVDTSQDHVLHPPVA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G314650`
TK1151 ID	TkA04G314650
OH-1004 ID	LXL04_037512
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G314650

Location Chr04:79307113-79309082 (-)

Description Similar to ILR3: Transcription factor ILR3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54680`	Transcription factor.	An Arabidopsis basic helix-loop-helix leucine zipper protein modulates metal homeostasis and auxin conjugate responsiveness.2006 · DOI: 10.1534/genetics.106.061044
`At1g51070`	Transcription factor bHLH115.	No verified direct reference in this release
`At4g14410`	Transcription factor bHLH104.	No verified direct reference in this release
`At3g23210`	Transcription factor bHLH34.	No verified direct reference in this release
`At3g19860`	Transcription factor bHLH121.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037512 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0010030 positive regulation of seed germination Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process

GO:0071333 cellular response to glucose stimulus Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G51070

ath:AT3G19860

ath:AT3G23210

ath:AT4G14410

ath:AT5G54680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.973

Rank 1 · TkA04G314650 · TK1151

Cytoplasm0.120

Rank 2 · TkA04G314650 · TK1151

Cell membrane0.022

Rank 3 · TkA04G314650 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA04G314650 · TK1151

Plastid0.008

Rank 5 · TkA04G314650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13600DUF414019-56 aa

PF08644SPT1628-48 aa

PF09726Macoilin42-191 aa

PF13476AAA_2372-190 aa

PF10267Tmemb_cc284-190 aa

PF29075NOCA1_mid87-96 aa

PF30829MIA2_CC88-151 aa

PF23177bHLH_IRO393-181 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G314650	`PF13600`	DUF4140	19	56	0.002	19.3
TkA04G314650	`PF08644`	SPT16	28	48	0.3	12.2
TkA04G314650	`PF09726`	Macoilin	42	191	0.18	11.1
TkA04G314650	`PF13476`	AAA_23	72	190	0.0056	18.1
TkA04G314650	`PF10267`	Tmemb_cc2	84	190	0.086	12.8
TkA04G314650	`PF29075`	NOCA1_mid	87	96	0.36	11.4
TkA04G314650	`PF30829`	MIA2_CC	88	151	2.4	6.8
TkA04G314650	`PF23177`	bHLH_IRO3	93	181	1.9e-42	144.2
TkA04G314650	`PF00010`	HLH	95	143	4.2e-09	36.8
TkA04G314650	`PF03879`	Cgr1	96	107	1.1	10.4
TkA04G314650	`PF23435`	DUF7121	101	113	0.0067	16.6
TkA04G314650	`PF30671`	CCDC170_1st	104	191	0.02	15.0
TkA04G314650	`PF13600`	DUF4140	123	190	0.002	19.3
TkA04G314650	`PF23649`	FKBP15	129	194	0.0017	18.7
TkA04G314650	`PF02888`	CaMBD	131	193	0.069	14.0
TkA04G314650	`PF20492`	ERM_helical	132	192	0.012	16.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FH37`	Arabidopsis thaliana	sp\|Q9FH37\|ILR3_ARATH Transcription factor ILR3	62.700%	Swiss-Prot	High
`Q9C682`	Arabidopsis thaliana	sp\|Q9C682\|BH115_ARATH Transcription factor bHLH115	52.400%	Swiss-Prot	High
`Q8L467`	Arabidopsis thaliana	sp\|Q8L467\|BH104_ARATH Transcription factor bHLH104	48.600%	Swiss-Prot	Medium
`Q9LTC7`	Arabidopsis thaliana	sp\|Q9LTC7\|BH034_ARATH Transcription factor bHLH34	48.600%	Swiss-Prot	Medium
`Q9LT23`	Arabidopsis thaliana	sp\|Q9LT23\|BH121_ARATH Transcription factor bHLH121	53.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card