TkA04G308330 | RubberDandelionOmics

Gene overview

TkA04G308330

Reference: TK1151 Chr: Chr04 Coordinates: 77793898-77797884 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1739 bp · TkA04G308330|TK1151|cDNA

CAAATTTTGTTTTAAATCCATAAGTGAATACAAAATTTACATTTGTGATTTGACTGGACAAAATTAATTGACTTGTAATTCAGTAGTCAACACCGAGATGTGATTGGTGGAGATTTGGCGCAAAAAAAGCATAACCGAGGGCCCAAAGAAAACGGTTGGAATTTGGAAATACAACGAGAAACGGAAACGCATTCTTCTCCGGTTTTCATCTCCATTGAAAATCCAGATTTCTCGAAACCAGAATGATCAGATGGATAAAA...

CDS

Download CDS FASTA

1467 bp · TkA04G308330|TK1151|CDS

ATGATCAGATGGATAAAACAGTTGGGGATCATATTCGGGGCTTCGTTTCTCTGGCTCGTTTGCTTGATTTACTTTACCCAGGGTTTTAGATCTTTCGTATGGACAGCAGTTTCCTACCAGCTGAAAGACAAACTAAAGCTATCGCCTTCATCTTCTCAATTCGTAACCTCCATATCGTTTTTTCCATGGAGCTTGAAACCAGTATACGGGATCATATCAGATTGTATCCCAGTAAATGGAAGGAAAAGGGTTCCTTATTT...

Protein

Download Protein FASTA

488 aa · TkA04G308330|TK1151|PROTEIN

MIRWIKQLGIIFGASFLWLVCLIYFTQGFRSFVWTAVSYQLKDKLKLSPSSSQFVTSISFFPWSLKPVYGIISDCIPVNGRKRVPYLVIATLLSLFSWAILGLQESSRDSQNQLMIFLLLQNLGSAMADVVIDAMIAEAARREKAKYGGDLQSISWMAMSLGGIFGSLFGGYALTNLQMSNIFLLFSFLPTIQLLSCGFVTETPITSPEFLSINDSSGPDEERSSHESPNKPPRALVRKRSHKISKKTISDNVKDQMYLK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G308330`
TK1151 ID	TkA04G308330
OH-1004 ID	LXL04_037441
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G308330

Location Chr04:77793898-77797884 (-)

Description Similar to At5g54860: Probable folate-biopterin transporter 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54860`	Could mediate folate transport.	No verified direct reference in this release
`At2g32040`	Mediates folate monoglutamate transport involved in tetrahydrofolate biosynthesis.	Higher plant plastids and cyanobacteria have folate carriers related to those of trypanosomatids.2005 · DOI: 10.1074/jbc.m507432200 Identification of transport-critical residues in a folate transporter from the folate-biopterin transporter (FBT) family.2010 · DOI: 10.1074/jbc.m109.063651
`At5g25050`	Could mediate folate transport.	No verified direct reference in this release
`At1g79710`	Could mediate folate transport.	No verified direct reference in this release
`At5g25040`	Could mediate folate transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037441 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0051958 methotrexate transport Biological Process

GO:0098838 folate transmembrane transport Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0016020 membrane Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0008517 folic acid transmembrane transporter activity Molecular Function

GO:0015231 5-formyltetrahydrofolate transmembrane transporter activity Molecular Function

GO:0015350 methotrexate transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G04570

ath:AT1G64890

ath:AT2G32040

ath:AT2G33280

ath:AT5G54860

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.392

Rank 1 · TkA04G308330 · TK1151

Endoplasmic reticulum0.199

Rank 2 · TkA04G308330 · TK1151

Golgi apparatus0.171

Rank 3 · TkA04G308330 · TK1151

Cell membrane0.117

Rank 4 · TkA04G308330 · TK1151

Cytoplasm0.109

Rank 5 · TkA04G308330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07690MFS_125-437 aa

PF03092BT127-481 aa

PF03209PUCC57-179 aa

PF09716ETRAMP180-228 aa

PF07690MFS_1312-482 aa

PF09716ETRAMP343-372 aa

PF03209PUCC411-476 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G308330	`PF07690`	MFS_1	25	437	7e-21	75.2
TkA04G308330	`PF03092`	BT1	27	481	1.8e-105	353.9
TkA04G308330	`PF03209`	PUCC	57	179	0.0013	18.6
TkA04G308330	`PF09716`	ETRAMP	180	228	0.098	13.4
TkA04G308330	`PF07690`	MFS_1	312	482	7e-21	75.2
TkA04G308330	`PF09716`	ETRAMP	343	372	0.098	13.4
TkA04G308330	`PF03209`	PUCC	411	476	0.0013	18.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWQ5`	Arabidopsis thaliana	sp\|Q8RWQ5\|FBT4_ARATH Probable folate-biopterin transporter 4	63.400%	Swiss-Prot	High
`Q9SKZ5`	Arabidopsis thaliana	sp\|Q9SKZ5\|FBT1_ARATH Folate-biopterin transporter 1, chloroplastic	31.800%	Swiss-Prot	Medium
`Q5FV41`	Arabidopsis thaliana	sp\|Q5FV41\|FBT2_ARATH Probable folate-biopterin transporter 2	27.400%	Swiss-Prot	Low
`Q9SQN2`	Arabidopsis thaliana	sp\|Q9SQN2\|FBT3_ARATH Probable folate-biopterin transporter 3	26.000%	Swiss-Prot	Low
`F4KIL8`	Arabidopsis thaliana	sp\|F4KIL8\|FBT5_ARATH Probable folate-biopterin transporter 5	26.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card