TkA04G307430 | RubberDandelionOmics

Gene overview

TkA04G307430

Reference: TK1151 Chr: Chr04 Coordinates: 77578586-77579171 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

344 bp · TkA04G307430|TK1151|cDNA

TCTTGATGAGGATGGTGGTCCCTATGAGTCAAGTGATTAAAAATAAAAAGAAAATCGGCGAAGAAAACGTACGAAAAGCTGTTGAAACCGTCACTAAAGCAGCAGAAGTTGCTTTGTCTGAAGGAAAAGCTTTCTGCATTTCACACGTCTGTGTGGGTTCAGACACTGCTGCTATTCGTGAAGCAGTTGTGAAAACCATGGAGCAAAAGGGAATGGCGGTGATGGTATTCAGCACTGATGAACAATCAAAAAAGACTCTA...

CDS

Download CDS FASTA

339 bp · TkA04G307430|TK1151|CDS

ATGAGGATGGTGGTCCCTATGAGTCAAGTGATTAAAAATAAAAAGAAAATCGGCGAAGAAAACGTACGAAAAGCTGTTGAAACCGTCACTAAAGCAGCAGAAGTTGCTTTGTCTGAAGGAAAAGCTTTCTGCATTTCACACGTCTGTGTGGGTTCAGACACTGCTGCTATTCGTGAAGCAGTTGTGAAAACCATGGAGCAAAAGGGAATGGCGGTGATGGTATTCAGCACTGATGAACAATCAAAAAAGACTCTAGTATG...

Protein

Download Protein FASTA

113 aa · TkA04G307430|TK1151|PROTEIN

MRMVVPMSQVIKNKKKIGEENVRKAVETVTKAAEVALSEGKAFCISHVCVGSDTAAIREAVVKTMEQKGMAVMVFSTDEQSKKTLVCAGVPINSNKSEQLKVKEWLDAALKPI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G307430`
TK1151 ID	TkA04G307430
OH-1004 ID	LXL04_037428
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 24.512 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G307430

Location Chr04:77578586-77579171 (-)

Description Similar to ALATS: Alanine--tRNA ligase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g50200`	Catalyzes the attachment of alanine to tRNA(Ala) in a two-step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037428 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006419 alanyl-tRNA aminoacylation Biological Process

GO:0070143 mitochondrial alanyl-tRNA aminoacylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000049 tRNA binding Molecular Function

GO:0002161 aminoacyl-tRNA deacylase activity Molecular Function

GO:0004813 alanine-tRNA ligase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G50200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.659

Rank 1 · TkA04G307430 · TK1151

Nucleus0.276

Rank 2 · TkA04G307430 · TK1151

Mitochondrion0.133

Rank 3 · TkA04G307430 · TK1151

Extracellular0.079

Rank 4 · TkA04G307430 · TK1151

Cell membrane0.078

Rank 5 · TkA04G307430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02272DHHA119-31 aa

PF21770MgtC_SapB_C20-34 aa

PF00936BMC25-67 aa

PF19487DUF602332-69 aa

PF21770MgtC_SapB_C45-100 aa

PF02272DHHA150-109 aa

PF04320YggL_50S_bp55-108 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G307430	`PF02272`	DHHA1	19	31	0.0005	21.2
TkA04G307430	`PF21770`	MgtC_SapB_C	20	34	0.053	14.7
TkA04G307430	`PF00936`	BMC	25	67	0.32	11.7
TkA04G307430	`PF19487`	DUF6023	32	69	0.039	14.7
TkA04G307430	`PF21770`	MgtC_SapB_C	45	100	0.053	14.7
TkA04G307430	`PF02272`	DHHA1	50	109	0.0005	21.2
TkA04G307430	`PF04320`	YggL_50S_bp	55	108	0.14	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P36428`	Arabidopsis thaliana	sp\|P36428\|SYA_ARATH Alanine--tRNA ligase	54.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card