LXL04_037428 | RubberDandelionOmics

Gene overview

LXL04_037428

Reference: OH-1004 Chr: Chr09 Coordinates: 10892420-10895277 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1386 bp · LXL04_037428|LXL04_037428|OH1004|cDNA

aTGAGGATGGTGGTCCCTATGAGTCAAGtgattaaaaataaaaagaaaatcgGCGAAGAAAACGTACGAAAAGCTGTTGAAACCGTCACTAAAGCAGCAGAAGTTGCTTTGTCTGAAGGAAAAGCTTTCTGCATTTCACACGTCTGTGTGGGTTCAGACACTGCTGCTATTCGTGAAGCAGTTGTGAAAACCATGGAGCAAAAGGGAATGGCGGTGATGGTATTCAGCACAGATGAACAATCAAAAAAGACTCTAGTATG...

CDS

Download CDS FASTA

1386 bp · LXL04_037428|LXL04_037428|OH1004|CDS

ATGAGGATGGTGGTCCCTATGAGTCAAGTGATTAAAAATAAAAAGAAAATCGGCGAAGAAAACGTACGAAAAGCTGTTGAAACCGTCACTAAAGCAGCAGAAGTTGCTTTGTCTGAAGGAAAAGCTTTCTGCATTTCACACGTCTGTGTGGGTTCAGACACTGCTGCTATTCGTGAAGCAGTTGTGAAAACCATGGAGCAAAAGGGAATGGCGGTGATGGTATTCAGCACAGATGAACAATCAAAAAAGACTCTAGTATG...

Protein

Download Protein FASTA

461 aa · LXL04_037428|LXL04_037428|OH1004|PROTEIN

MRMVVPMSQVIKNKKKIGEENVRKAVETVTKAAEVALSEGKAFCISHVCVGSDTAAIREAVVKTMEQKGMAVMVFSTDEQSKKTLVCAGVPINSNKSEQLKVKEWLDAALKPIYFVFMADFEAPSFSLGLDCDSDPEPEPEPQISFVSEEDDYGSLIVDDSEPAFYSDPHPKLKRLRRLLTTDVTTTTTSSSTISEKSKAELNTSPVIGDEDDDVFCLQEDGLTDEHLHTQNCALTNQSGKKSQTIGQRRRFLLTLSDSD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037428`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037428

Location Chr09:10892420-10895277 (-)

Description Similar to ALATS: Alanine--tRNA ligase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g50200`	Catalyzes the attachment of alanine to tRNA(Ala) in a two-step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037428 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006419 alanyl-tRNA aminoacylation Biological Process

GO:0070143 mitochondrial alanyl-tRNA aminoacylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000049 tRNA binding Molecular Function

GO:0002161 aminoacyl-tRNA deacylase activity Molecular Function

GO:0004813 alanine-tRNA ligase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G50200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.882

Rank 1 · LXL04_037428 · OH-1004

Cytoplasm0.218

Rank 2 · LXL04_037428 · OH-1004

Mitochondrion0.036

Rank 3 · LXL04_037428 · OH-1004

Cell membrane0.024

Rank 4 · LXL04_037428 · OH-1004

Golgi apparatus0.014

Rank 5 · LXL04_037428 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P36428`	Arabidopsis thaliana	Alanine--tRNA ligase	54.717%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card