TkA04G301030 | RubberDandelionOmics

Gene overview

TkA04G301030

Reference: TK1151 Chr: Chr04 Coordinates: 76119337-76121666 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1041 bp · TkA04G301030|TK1151|cDNA

ATGATCCGAGAAGTTCACTTCCCCAAGTGGCTAGCAAACGTGGTGGTGATCCAGAAGAAGAATGGGAAGTGGAGAGTATGCGTGGTCTTCACGGATCTCAACAAGGCCTGCCCAAAGGATCCTTTCCCTTTGCCTCACATTGATTCCGTGATCGATGCCACAGCCGGTCATGAACTTCTCACATTCACAGATGCCTCATCAGGATTCCATCAGATCCAAATGGAACATTCTGACCAAGAGGATACCGCATTCATAACTCC...

CDS

Download CDS FASTA

1041 bp · TkA04G301030|TK1151|CDS

ATGATCCGAGAAGTTCACTTCCCCAAGTGGCTAGCAAACGTGGTGGTGATCCAGAAGAAGAATGGGAAGTGGAGAGTATGCGTGGTCTTCACGGATCTCAACAAGGCCTGCCCAAAGGATCCTTTCCCTTTGCCTCACATTGATTCCGTGATCGATGCCACAGCCGGTCATGAACTTCTCACATTCACAGATGCCTCATCAGGATTCCATCAGATCCAAATGGAACATTCTGACCAAGAGGATACCGCATTCATAACTCC...

Protein

Download Protein FASTA

346 aa · TkA04G301030|TK1151|PROTEIN

MIREVHFPKWLANVVVIQKKNGKWRVCVVFTDLNKACPKDPFPLPHIDSVIDATAGHELLTFTDASSGFHQIQMEHSDQEDTAFITPTCIYCYIAMPFGLKNAGATYQRLVNRMFNDKLGDTMEVYIDDMVVKSKKAEDHLRDLEEASRILDEYNMKLNPSKCHFGVKTGKFLVYMVTKRGIEASPEQIKAIINLKAPSSTKDIQRLTGRVAALNRFISRSSERCKPFYDILKKNKRFEWKEEHEKAFQNLKSYLSTAPL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G301030`
TK1151 ID	TkA04G301030
OH-1004 ID	LXL04_039299
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	89.600
Protein coverage (%)	TK1151 89.306 / OH-1004 9.888 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G301030`
Location	Chr04:76119337-76121666 (-)
Description	Similar to pol: Retrovirus-related Pol polyprotein from transposon 297
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_039299` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006281 DNA repair Biological Process GO:0006313 DNA transposition Biological Process GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0005634 nucleus Cellular Component GO:0042575 DNA polymerase complex Cellular Component GO:0003676 nucleic acid binding Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004190 aspartic-type endopeptidase activity Molecular Function GO:0004519 endonuclease activity Molecular Function GO:0008233 peptidase activity Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.641

Rank 1 · TkA04G301030 · TK1151

Nucleus0.197

Rank 2 · TkA04G301030 · TK1151

Mitochondrion0.156

Rank 3 · TkA04G301030 · TK1151

Cell membrane0.071

Rank 4 · TkA04G301030 · TK1151

Endoplasmic reticulum0.050

Rank 5 · TkA04G301030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17917RT_RNaseH14-27 aa

PF00078RVT_117-175 aa

PF23067MG280135-239 aa

PF00336DNA_pol_viral_C192-282 aa

PF17919RT_RNaseH_2240-311 aa

PF17917RT_RNaseH268-311 aa

PF21994AGAO-like_N2287-334 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G301030	`PF17917`	RT_RNaseH	14	27	0.0011	19.8
TkA04G301030	`PF00078`	RVT_1	17	175	1.6e-31	110.5
TkA04G301030	`PF23067`	MG280	135	239	0.013	15.8
TkA04G301030	`PF00336`	DNA_pol_viral_C	192	282	0.17	12.0
TkA04G301030	`PF17919`	RT_RNaseH_2	240	311	1.1e-13	51.7
TkA04G301030	`PF17917`	RT_RNaseH	268	311	0.0011	19.8
TkA04G301030	`PF21994`	AGAO-like_N2	287	334	0.092	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card