LXL04_039299 | RubberDandelionOmics

Gene overview

LXL04_039299

Reference: OH-1004 Chr: JAJTUU010000010.1 Coordinates: 802567-823921 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

9378 bp · LXL04_039299|LXL04_039299|OH1004|cDNA

atgatcagagaagtgcacttcccaaagTGGCTAGCAAACatggtggtagtacaaaagaagaacggaaaatggagagtttgtgtagatttcacagatctcaacaaagcatgtccaaaagatccatttccgctaccccacatcgattcgatgattgacgcaacaaTTGGTCATGAATtactcacattcatggacgtatcctcaggctttcatcaaatacaaatcgaaccttctgatcaagaagataccgccttcataactcc...

CDS

Download CDS FASTA

9378 bp · LXL04_039299|LXL04_039299|OH1004|CDS

ATGATCAGAGAAGTGCACTTCCCAAAGTGGCTAGCAAACATGGTGGTAGTACAAAAGAAGAACGGAAAATGGAGAGTTTGTGTAGATTTCACAGATCTCAACAAAGCATGTCCAAAAGATCCATTTCCGCTACCCCACATCGATTCGATGATTGACGCAACAATTGGTCATGAATTACTCACATTCATGGACGTATCCTCAGGCTTTCATCAAATACAAATCGAACCTTCTGATCAAGAAGATACCGCCTTCATAACTCC...

Protein

Download Protein FASTA

3125 aa · LXL04_039299|LXL04_039299|OH1004|PROTEIN

MIREVHFPKWLANMVVVQKKNGKWRVCVDFTDLNKACPKDPFPLPHIDSMIDATIGHELLTFMDVSSGFHQIQIEPSDQEDTAFITPTGIYCYTAMPFGLKNVGVTYQRPVNRMFKDKLGDTMEVYIDEMVVISKKAEDHLRDLEEAFRILDEYNMKLNPAKCHFGVKAGKFLGYMVTKRGIEAQPRTNKSHDQLKAPSSVKDIQRLTGRIAALNRFISRSSDRCKPFYDILKKNKKFEWKEEHEKSFQELKTYLSTPPL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039299`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_039299`
Location	JAJTUU010000010.1:802567-823921 (-)
Description	Similar to pol: Retrovirus-related Pol polyprotein from transposon 297
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_039299` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006281 DNA repair Biological Process GO:0006313 DNA transposition Biological Process GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0005634 nucleus Cellular Component GO:0042575 DNA polymerase complex Cellular Component GO:0003676 nucleic acid binding Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004190 aspartic-type endopeptidase activity Molecular Function GO:0004519 endonuclease activity Molecular Function GO:0008233 peptidase activity Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.701

Rank 1 · LXL04_039299 · OH-1004

Nucleus0.313

Rank 2 · LXL04_039299 · OH-1004

Mitochondrion0.096

Rank 3 · LXL04_039299 · OH-1004

Cell membrane0.059

Rank 4 · LXL04_039299 · OH-1004

Endoplasmic reticulum0.051

Rank 5 · LXL04_039299 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00078.33RVT_117-176 aa

PF17919.8RT_RNaseH_2240-299 aa

PF13456.13RVT_3345-431 aa

PF13456.13RVT_3586-672 aa

PF17921.8Integrase_H2C2788-843 aa

PF00665.33rve862-957 aa

PF29688.1TnsB_C918-975 aa

PF31073.1DUF88031080-1133 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039299	`PF00078.33`	RVT_1	17	176	1.5e-67	228.1
LXL04_039299	`PF17919.8`	RT_RNaseH_2	240	299	5.4e-33	113.7
LXL04_039299	`PF13456.13`	RVT_3	345	431	7.9e-45	152.5
LXL04_039299	`PF13456.13`	RVT_3	586	672	7.9e-45	152.5
LXL04_039299	`PF17921.8`	Integrase_H2C2	788	843	1.9e-18	67.0
LXL04_039299	`PF00665.33`	rve	862	957	2.4e-13	50.9
LXL04_039299	`PF29688.1`	TnsB_C	918	975	1.5e-06	28.8
LXL04_039299	`PF31073.1`	DUF8803	1080	1133	4.9e-18	65.4
LXL04_039299	`PF03732.25`	PEG10_N-capsid	1871	1942	3.2e-07	31.3
LXL04_039299	`PF00078.33`	RVT_1	2415	2574	1.5e-67	228.1
LXL04_039299	`PF17919.8`	RT_RNaseH_2	2638	2736	5.4e-33	113.7
LXL04_039299	`PF17917.8`	RT_RNaseH	2666	2765	1.9e-19	70.5
LXL04_039299	`PF00075.31`	RNase_H	2810	2883	1.5e-11	45.3
LXL04_039299	`PF13456.13`	RVT_3	2815	2932	7.9e-45	152.5
LXL04_039299	`PF17921.8`	Integrase_H2C2	3047	3103	1.9e-18	67.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card