TkA04G296770 | RubberDandelionOmics

Gene overview

TkA04G296770

Reference: TK1151 Chr: Chr04 Coordinates: 75070703-75072020 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

717 bp · TkA04G296770|TK1151|cDNA

AAAAAGGTGGGATTACCGACATCGCCACCTTATCTATCACTGATCGGAAGTGCAACATTGCCGATCACCGGAGTCAGCTTTGCATCTGGAGCTGACGTGCACCTATCAAAGACCCTGTTTGCGATAGTTATCGGAAGCAATGATCTTTTTGCCTACTTTACAACGGGTTCAGCAGTCTCTATCAAGTACACCCCACAACAGTTTGTCGATCTTATGGTGTCCACCTACAAAGGTCTACTCAAGATGTTATATGGATTGGG...

CDS

Download CDS FASTA

504 bp · TkA04G296770|TK1151|CDS

AAAAAGGTGGGATTACCGACATCGCCACCTTATCTATCACTGATCGGAAGTGCAACATTGCCGATCACCGGAGTCAGCTTTGCATCTGGAGCTGACGTGCACCTATCAAAGACCCTGTTTGCGATAGTTATCGGAAGCAATGATCTTTTTGCCTACTTTACAACGGGTTCAGCAGTCTCTATCAAGTACACCCCACAACAGTTTGTCGATCTTATGGTGTCCACCTACAAAGGTCTACTCAAGATGTTATATGGATTGGG...

Protein

Download Protein FASTA

167 aa · TkA04G296770|TK1151|PROTEIN

KKVGLPTSPPYLSLIGSATLPITGVSFASGADVHLSKTLFAIVIGSNDLFAYFTTGSAVSIKYTPQQFVDLMVSTYKGLLKMLYGLGARKVMVTGVGAIGCCPIQRKSNKTGGCNTGLNYWSTKYNDGLKLMLQDMQLQSSGLKYAYFDIYGAMTNLFLEPQTYGTY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G296770`
TK1151 ID	TkA04G296770
OH-1004 ID	LXL04_037412
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	79.700
Protein coverage (%)	TK1151 98.802 / OH-1004 55.946 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G296770

Location Chr04:75070703-75072020 (-)

Description Similar to At5g55050: GDSL esterase/lipase At5g55050

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g55050`	GDSL esterase/lipase At5g55050.	No verified direct reference in this release
`At1g74460`	GDSL esterase/lipase At1g74460.	No verified direct reference in this release
`At1g33811`	GDSL esterase/lipase At1g33811.	No verified direct reference in this release
`At5g33370`	GDSL esterase/lipase At5g33370.	No verified direct reference in this release
`At3g04290`	Involved in the mechanisms of salt tolerance.	Overexpression of Arabidopsis thaliana LTL1, a salt-induced gene encoding a GDSL-motif lipase, increases salt tolerance in yeast and transgenic plants.2006 · DOI: 10.1111/j.1365-3040.2006.01565.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037412 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016298 lipase activity Molecular Function

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

KEGG gene cross-reference

ath:AT1G74460

ath:AT3G50400

ath:AT4G16230

ath:AT5G37690

ath:AT5G55050

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.798

Rank 1 · TkA04G296770 · TK1151

Cytoplasm0.078

Rank 2 · TkA04G296770 · TK1151

Endoplasmic reticulum0.052

Rank 3 · TkA04G296770 · TK1151

Lysosome / Vacuole0.043

Rank 4 · TkA04G296770 · TK1151

Cell membrane0.023

Rank 5 · TkA04G296770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657Lipase_GDSL33-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G296770	`PF00657`	Lipase_GDSL	33	155	1.5e-14	55.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FIA1`	Arabidopsis thaliana	sp\|Q9FIA1\|GDL87_ARATH GDSL esterase/lipase At5g55050	41.000%	Swiss-Prot	Medium
`Q9CA68`	Arabidopsis thaliana	sp\|Q9CA68\|GDL31_ARATH GDSL esterase/lipase At1g74460	31.600%	Swiss-Prot	Medium
`Q8L5Z1`	Arabidopsis thaliana	sp\|Q8L5Z1\|GDL17_ARATH GDSL esterase/lipase At1g33811	35.000%	Swiss-Prot	Medium
`Q8LB81`	Arabidopsis thaliana	sp\|Q8LB81\|GDL79_ARATH GDSL esterase/lipase At5g33370	28.400%	Swiss-Prot	Low
`Q9M8Y5`	Arabidopsis thaliana	sp\|Q9M8Y5\|LTL1_ARATH GDSL esterase/lipase LTL1	27.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card