TkA04G280690 | RubberDandelionOmics

Gene overview

TkA04G280690

Reference: TK1151 Chr: Chr04 Coordinates: 70687264-70691625 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2690 bp · TkA04G280690|TK1151|cDNA

GTCGGACTGGTCGTAGTGAAGAAGACGGGGTGAAGAAGACTGGTTCAGAGCATACCGAAGGATCAACGAAATTGAGAAAACGAATTCACACCTTATGTTTGGAATCGGACGATTGTTGGGCGTCGGCGTCTACATGATCAACGCGATCAAAATCGAGAACCGATTTGATTGAAGACGACCAGTTCCTCTTCTTCGGGAACCCTCCAACACTCTTGAGAACAGTCGCACCAGCTCCAAGCAATCTCCGATTAGTCCGTTTA...

CDS

Download CDS FASTA

378 bp · TkA04G280690|TK1151|CDS

ATGGATAAAGCCTCCATAATTAAAGACGCGATTGATTATATTCAACATTTGCGTGAACAAGAGAGGACTATTCAAGATGAAATAATTAAACTGGAGTCTCGAAAGTCAGAATCTGGGATTTATGATTTCGATCAAGAGACGGTGTTTATGTCAAGAGAAAGATCCAAGAAGAAAAGGATTAATCAATCTCCAGATTCAAATGAATCAAGGGCGTTTCCGGTTGAAGTTCTTGAGTTAAACGTTTCATACGTGGGAGAAAA...

Protein

Download Protein FASTA

125 aa · TkA04G280690|TK1151|PROTEIN

MDKASIIKDAIDYIQHLREQERTIQDEIIKLESRKSESGIYDFDQETVFMSRERSKKKRINQSPDSNESRAFPVEVLELNVSYVGEKTALVSLKCRKRRDTMVKICEVFESLKLIVVNCQHNYFS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G280690`
TK1151 ID	TkA04G280690
OH-1004 ID	LXL04_017961
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	66.400
Protein coverage (%)	TK1151 100.000 / OH-1004 51.867 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G280690

Location Chr04:70687264-70691625 (-)

Description Similar to BHLH35: Transcription factor bHLH35

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g29930`	Transcription factor bHLH27.	No verified direct reference in this release
`At5g57150`	Transcription factor bHLH35.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0301500`	Transcription factor involved in phosphate starvation response.	RERJ1, a jasmonic acid-responsive gene from rice, encodes a basic helix-loop-helix protein.2004 · DOI: 10.1016/j.bbrc.2004.10.126 Stress-induced expression of the transcription factor RERJ1 is tightly regulated in response to jasmonic acid accumulation in rice.2013 · DOI: 10.1007/s00709-012-0400-z OsbHLH6 interacts with OsSPX4 and regulates the phosphate starvation response in rice.2021 · DOI: 10.1111/tpj.15061

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017961 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009555 pollen development Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0010039 response to iron ion Biological Process

GO:0034756 regulation of iron ion transport Biological Process

GO:0048658 anther wall tapetum development Biological Process

GO:0048831 regulation of shoot system development Biological Process

GO:0055062 phosphate ion homeostasis Biological Process

GO:0080040 positive regulation of cellular response to phosphate starvation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT2G16910

ath:AT2G28160

ath:AT4G29930

ath:AT5G57150

dosa:Os04g0301500

osa:4335417

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.910

Rank 1 · TkA04G280690 · TK1151

Cytoplasm0.198

Rank 2 · TkA04G280690 · TK1151

Cell membrane0.028

Rank 3 · TkA04G280690 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkA04G280690 · TK1151

Mitochondrion0.013

Rank 5 · TkA04G280690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23177bHLH_IRO31-33 aa

PF00010HLH2-18 aa

PF23177bHLH_IRO351-62 aa

PF00010HLH52-62 aa

PF22754bHLH-TF_ACT-like_plant78-120 aa

PF00010HLH96-116 aa

PF23177bHLH_IRO398-102 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G280690	`PF23177`	bHLH_IRO3	1	33	0.0099	16.9
TkA04G280690	`PF00010`	HLH	2	18	0.029	14.9
TkA04G280690	`PF23177`	bHLH_IRO3	51	62	0.0099	16.9
TkA04G280690	`PF00010`	HLH	52	62	0.029	14.9
TkA04G280690	`PF22754`	bHLH-TF_ACT-like_plant	78	120	1.2e-14	54.9
TkA04G280690	`PF00010`	HLH	96	116	0.029	14.9
TkA04G280690	`PF23177`	bHLH_IRO3	98	102	0.0099	16.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q700E3`	Arabidopsis thaliana	sp\|Q700E3\|BH027_ARATH Transcription factor bHLH27	40.600%	Swiss-Prot	Medium
`Q2HIV9`	Arabidopsis thaliana	sp\|Q2HIV9\|BH035_ARATH Transcription factor bHLH35	46.500%	Swiss-Prot	Medium
`Q0JEB7`	Oryza sativa subsp. japonica	sp\|Q0JEB7\|BH006_ORYSJ Transcription factor BHLH6	36.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card