TkA04G280650 | RubberDandelionOmics

Gene overview

TkA04G280650

Reference: TK1151 Chr: Chr04 Coordinates: 70680500-70682681 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1431 bp · TkA04G280650|TK1151|cDNA

AATAAGAGTTTTTTTTGTAGAAGTCATATTAGAGTAATAATAGTTTTCTAACAAAACCTCGTAAAGCGGTAAAGGTAATCACTGAACGTATAAAAAATTTCAGGAATAATTCTAACTAATGGTAAAAGAAACACTTATACGATTTTCTACATGAACAACCTCAAAAGACGAAGTCCAGTAGTACATAAACAATACTATATGTCTAGATCACACCCTTGTCAACCACACAATAAATGACATATTTATAGCCAAAAACAAAC...

CDS

Download CDS FASTA

849 bp · TkA04G280650|TK1151|CDS

ATGTCTTCAAACGATGCACCAACTTCTTTGGAGCCGCAAGATCCAATTCCAATCATTGACTACTCCTTACTCACTTCTGGTACTGTTGACGAGCATTCAAAAGTCGTCCAAGATATTGGGAAAGCCTGTGAAGATTGGGGCTGCTTCATGTTGGTAAATCACGGTATCCCATACACTTTGATCAAAGAGATGATGGACGGGTCGAATGAGTTTTTCAATATGACGAAAGACGAAAAGCTTGAATTTGAAGCTCATGGTGT...

Protein

Download Protein FASTA

282 aa · TkA04G280650|TK1151|PROTEIN

MSSNDAPTSLEPQDPIPIIDYSLLTSGTVDEHSKVVQDIGKACEDWGCFMLVNHGIPYTLIKEMMDGSNEFFNMTKDEKLEFEAHGVLDPIRCSTGFIPNNNNKDLFVEGISSAYCSSRFHCPHKPLGFSELASVYVKNTRTVAMELVKGVSESLGFEASYMHDQLNLDSGFQLLAINYYPSLMEFDGARGLMPHTDHGLLTLLYENGVPGLEVIRKGKWIGMSDVSNAFAVLNSDHMEIFSNGKYKSKLHRTVVKDERT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G280650`
TK1151 ID	TkA04G280650
OH-1004 ID	LXL04_002981
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	95.300
Protein coverage (%)	TK1151 97.163 / OH-1004 85.358 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G280650

Location Chr04:70680500-70682681 (-)

Description Similar to 2ODD19: 2-oxoglutarate-dependent dioxygenase 19

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g10490`	Converts salicylic acid (SA) to 2,3-dihydroxybenzoic acid (2,3-DHBA) (By similarity).	DOWNY MILDEW RESISTANT 6 and DMR6-LIKE OXYGENASE 1 are partially redundant but distinct suppressors of immunity in Arabidopsis.2015 · DOI: 10.1111/tpj.12719
`At4g10500`	Converts salicylic acid (SA) to both 2,3-dihydroxybenzoic acid (2,3-DHBA) and 2,5-DHBA in vitro but only 2,3-DHBA in vivo.	DOWNY MILDEW RESISTANT 6 and DMR6-LIKE OXYGENASE 1 are partially redundant but distinct suppressors of immunity in Arabidopsis.2015 · DOI: 10.1111/tpj.12719
`At3g21420`	Oxoglutarate-dependent dioxygenase involved in the biosynthesis of strigolactone natural products, bioactive compounds promoting plant fitness and soil microbe interactions, but preventing shoot branching.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0480200`	Involved in melatonin degradation.	No verified direct reference in this release
`Os04g0667200`	Catalyzes the 3-beta-hydroxylation of 2S-flavanones to 2R,3R-dihydroflavonols which are intermediates in the biosynthesis of flavonols, anthocyanidins, catechins and proanthocyanidins in plants.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002981 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0002239 response to oomycetes Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0010150 leaf senescence Biological Process

GO:0046244 salicylic acid catabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016706 2-oxoglutarate-dependent dioxygenase activity Molecular Function

GO:0031418 L-ascorbic acid binding Molecular Function

KEGG gene cross-reference

ath:AT4G10490

ath:AT4G10500

dosa:Os08g0480200

dosa:Os10g0536400

osa:4345848

osa:4349238

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.806

Rank 1 · TkA04G280650 · TK1151

Nucleus0.317

Rank 2 · TkA04G280650 · TK1151

Endoplasmic reticulum0.054

Rank 3 · TkA04G280650 · TK1151

Peroxisome0.043

Rank 4 · TkA04G280650 · TK1151

Cell membrane0.040

Rank 5 · TkA04G280650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226DIOX_N16-84 aa

PF031712OG-FeII_Oxy173-264 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G280650	`PF14226`	DIOX_N	16	84	2.3e-19	70.9
TkA04G280650	`PF03171`	2OG-FeII_Oxy	173	264	7.6e-19	68.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZSA7`	Arabidopsis thaliana	sp\|Q9ZSA7\|DLO2_ARATH Protein DMR6-LIKE OXYGENASE 2	32.200%	Swiss-Prot	Medium
`Q9ZSA8`	Arabidopsis thaliana	sp\|Q9ZSA8\|DLO1_ARATH Protein DMR6-LIKE OXYGENASE 1	31.100%	Swiss-Prot	Medium
`Q9LIF4`	Arabidopsis thaliana	sp\|Q9LIF4\|LBO1_ARATH Protein LATERAL BRANCHING OXIDOREDUCTASE 1	30.600%	Swiss-Prot	Medium
`Q6Z244`	Oryza sativa subsp. japonica	sp\|Q6Z244\|ODD19_ORYSJ 2-oxoglutarate-dependent dioxygenase 19	41.200%	Swiss-Prot	Medium
`Q7XR84`	Oryza sativa subsp. japonica	sp\|Q7XR84\|FL3H3_ORYSJ Flavanone 3-dioxygenase 3	31.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card