TkA04G271990 | RubberDandelionOmics

Gene overview

TkA04G271990

Reference: TK1151 Chr: Chr04 Coordinates: 68732524-68734191 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1557 bp · TkA04G271990|TK1151|cDNA

CTTTGACTAACGTATAATGAAAAAACATAATTGTAATAACACATTGTTTTGCATTAGAATTATAATTTCCACAAACGTTAAATAATATGTTAAAAAAAACTATAGCAGTTAGTTTGATACTCTTTTATACGAACCATTGATAGTTAATCGAGAATAGAAGAATTTTATTCGGAATTAAAAGGATTTAAAAATCCAACCAGACCGCCTGCCCCAAAGCAAACGGCCACCAACTCATTGACACTTGACCATTGTCAAAAGTC...

CDS

Download CDS FASTA

687 bp · TkA04G271990|TK1151|CDS

ATGATGGAACGTCTGTACTCCGAAGTGAAGCTATTAACGTCGTTGAAGAACAAAAACATCATTACTCTGTTTCGGGAATGGAAAGACACGGAGCGAAACACCTTAAACTTCATCACCGAAGTTTGTACCTCCGGCAACCTCAGGGATTACCGGAAGAAACATAGACAGGTCTCGATGCAGGCGTTGAAGAAGTGGTCATGGCAAATATTAAAAGGTTTGGATTATCTACACAGACATGAACCATGTATCATTCACAGAGA...

Protein

Download Protein FASTA

228 aa · TkA04G271990|TK1151|PROTEIN

MMERLYSEVKLLTSLKNKNIITLFREWKDTERNTLNFITEVCTSGNLRDYRKKHRQVSMQALKKWSWQILKGLDYLHRHEPCIIHRDLNCSNVFINGNIGQVKIGDLGLAAIVGKSHCAHSILGTPEFMAPELYEEDYTELVDIYSFGMCLLEMVTLEVPYSECENIARIYKKVTSGIRPDAMKKVKDPEVKAFIDKCLAQPRARPSAADLLRDSFFHGISQDDDDEN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G271990`
TK1151 ID	TkA04G271990
OH-1004 ID	LXL04_037321
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 96.491 / OH-1004 82.707 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G271990

Location Chr04:68732524-68734191 (-)

Description Similar to WNK11: Probable serine/threonine-protein kinase WNK11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g55560`	May regulate flowering time by modulating the photoperiod pathway.	No verified direct reference in this release
`At3g48260`	May regulate flowering time by modulating the photoperiod pathway.	No verified direct reference in this release
`At1g49160`	May regulate flowering time by modulating the photoperiod pathway.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0584100`	Probable serine/threonine-protein kinase WNK5.	No verified direct reference in this release
`Os05g0108300`	Probable serine/threonine-protein kinase WNK2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037321 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G04910

ath:AT3G48260

ath:AT5G55560

dosa:Os05g0108300

dosa:Os07g0584100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.615

Rank 1 · TkA04G271990 · TK1151

Nucleus0.541

Rank 2 · TkA04G271990 · TK1151

Cell membrane0.071

Rank 3 · TkA04G271990 · TK1151

Mitochondrion0.049

Rank 4 · TkA04G271990 · TK1151

Endoplasmic reticulum0.040

Rank 5 · TkA04G271990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase3-217 aa

PF07714PK_Tyr_Ser-Thr3-213 aa

PF01636APH53-97 aa

PF17667Pkinase_fungal71-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G271990	`PF00069`	Pkinase	3	217	2.3e-44	152.5
TkA04G271990	`PF07714`	PK_Tyr_Ser-Thr	3	213	3.1e-33	115.9
TkA04G271990	`PF01636`	APH	53	97	0.03	14.8
TkA04G271990	`PF17667`	Pkinase_fungal	71	147	0.00092	18.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6ICW6`	Arabidopsis thaliana	sp\|Q6ICW6\|WNK11_ARATH Probable serine/threonine-protein kinase WNK11	76.800%	Swiss-Prot	High
`Q9STK6`	Arabidopsis thaliana	sp\|Q9STK6\|WNK3_ARATH Probable serine/threonine-protein kinase WNK3	64.800%	Swiss-Prot	High
`Q8LST2`	Arabidopsis thaliana	sp\|Q8LST2\|WNK7_ARATH Probable serine/threonine-protein kinase WNK7	62.700%	Swiss-Prot	High
`Q0D541`	Oryza sativa subsp. japonica	sp\|Q0D541\|WNK5_ORYSJ Probable serine/threonine-protein kinase WNK5	67.400%	Swiss-Prot	High
`Q65X23`	Oryza sativa subsp. japonica	sp\|Q65X23\|WNK2_ORYSJ Probable serine/threonine-protein kinase WNK2	62.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card