LXL04_037321 | RubberDandelionOmics

Gene overview

LXL04_037321

Reference: OH-1004 Chr: Chr09 Coordinates: 6031911-6032789 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

801 bp · LXL04_037321|LXL04_037321|OH1004|cDNA

ATGGAATTGGATTCTGGCGATCGGGACAAGGAGCTGTTTGTGGAGGTCGATCCGAGCGGCAGGTACGGACGCTACAGCGAGCTACTCGGTTCAGGGGCTGTGAAGAAAGTTTACAGGGCTTTCGACCAAGAGGAAGGGATCGAGCTATTAACGTCGTTGAAGAACAAAAACATCATTACTCTGTTTCGGGAATGGAAAGACACGGAGCGAAACACCTTAAACTTCATCACCGAAGTTTGTACCTCCGGCAACCTCAGGGA...

CDS

Download CDS FASTA

801 bp · LXL04_037321|LXL04_037321|OH1004|CDS

ATGGAATTGGATTCTGGCGATCGGGACAAGGAGCTGTTTGTGGAGGTCGATCCGAGCGGCAGGTACGGACGCTACAGCGAGCTACTCGGTTCAGGGGCTGTGAAGAAAGTTTACAGGGCTTTCGACCAAGAGGAAGGGATCGAGCTATTAACGTCGTTGAAGAACAAAAACATCATTACTCTGTTTCGGGAATGGAAAGACACGGAGCGAAACACCTTAAACTTCATCACCGAAGTTTGTACCTCCGGCAACCTCAGGGA...

Protein

Download Protein FASTA

266 aa · LXL04_037321|LXL04_037321|OH1004|PROTEIN

MELDSGDRDKELFVEVDPSGRYGRYSELLGSGAVKKVYRAFDQEEGIELLTSLKNKNIITLFREWKDTERNTLNFITEVCTSGNLRDYRKKHRQVSMQALKKWSWQILKGLDYLHRHEPCIIHRDLNCSNVFINGNIGQVKIGDLGLAAIVGKSHCAHSILGTPEFMAPELYEEDYTELVDIYSFGMCLLEMVTLEVPYSECENIARIYKKVTSGIRPDAMKKVKDPEVKAFIDKCLAQPRARPSAADLLRDSFFHGISQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037321`
TK1151 ID	TkA04G271990
OH-1004 ID	LXL04_037321
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 96.491 / OH-1004 82.707 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037321

Location Chr09:6031911-6032789 (-)

Description Similar to WNK11: Probable serine/threonine-protein kinase WNK11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g55560`	May regulate flowering time by modulating the photoperiod pathway.	No verified direct reference in this release
`At3g48260`	May regulate flowering time by modulating the photoperiod pathway.	No verified direct reference in this release
`At3g04910`	Regulates flowering time by modulating the photoperiod pathway.	The APRR3 component of the clock-associated APRR1/TOC1 quintet is phosphorylated by a novel protein kinase belonging to the WNK family, the gene for which is also transcribed rhythmically in Arabidopsis thaliana.2002 · DOI: 10.1093/pcp/pcf084 Compilation and characterization of a novel WNK family of protein kinases in Arabiodpsis thaliana with reference to circadian rhythms.2002 · DOI: 10.1271/bbb.66.2429 The plant WNK gene family and regulation of flowering time in Arabidopsis.2008 · DOI: 10.1111/j.1438-8677.2008.00072.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0584100`	Probable serine/threonine-protein kinase WNK5.	No verified direct reference in this release
`Os05g0108300`	Probable serine/threonine-protein kinase WNK2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037321 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G04910

ath:AT3G48260

ath:AT5G55560

dosa:Os05g0108300

dosa:Os07g0584100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.602

Rank 1 · LXL04_037321 · OH-1004

Nucleus0.513

Rank 2 · LXL04_037321 · OH-1004

Cell membrane0.079

Rank 3 · LXL04_037321 · OH-1004

Mitochondrion0.054

Rank 4 · LXL04_037321 · OH-1004

Endoplasmic reticulum0.044

Rank 5 · LXL04_037321 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr45-251 aa

PF00069.32Pkinase46-255 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037321	`PF07714.24`	PK_Tyr_Ser-Thr	45	251	8.7e-32	111.2
LXL04_037321	`PF00069.32`	Pkinase	46	255	4e-43	148.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6ICW6`	Arabidopsis thaliana	Probable serine/threonine-protein kinase WNK11	71.583%	Swiss-Prot	strong database homology
`Q9STK6`	Arabidopsis thaliana	Probable serine/threonine-protein kinase WNK3	58.719%	Swiss-Prot	strong database homology
`Q9CAV6`	Arabidopsis thaliana	Serine/threonine-protein kinase WNK1	58.242%	Swiss-Prot	strong database homology
`Q0D541`	Oryza sativa subsp. japonica	Probable serine/threonine-protein kinase WNK5	62.044%	Swiss-Prot	strong database homology
`Q65X23`	Oryza sativa subsp. japonica	Probable serine/threonine-protein kinase WNK2	56.429%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card