TkA04G262950 | RubberDandelionOmics

Gene overview

TkA04G262950

Reference: TK1151 Chr: Chr04 Coordinates: 66490735-66492355 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

982 bp · TkA04G262950|TK1151|cDNA

CACACATGTTTATATTTTGGTTGGAATTAAATTTTGTACCGAATTGAAAAAGTCCTTCCGCCACACCGCGTTAACATTACTGGCTTCCATGTCCATTTCCTGGATCTGACTGTTCTTCGCTGTCTTTCTCAAATCCCTTCCTTTTCTCTCTCCTATCCCTCCATTGTTGAAGTAGACGAAGACGAAGACGAAGAAGAGTGGACCAATACTCTAATTATCCATCAGTTTGCGGAACTTCAGCTGCTGATTCTTCAAGCATG...

CDS

Download CDS FASTA

561 bp · TkA04G262950|TK1151|CDS

ATGAAGATCGCGATCTTCGTTCTTCTTGTGCTCTGCTGCATCTCTATTTGTTTCTCTTCTCCGGTCTCCGTTTCAGATGGTGTCTTCGCCGCTGAAGCTTCGATTGGACGAAACCTTCTTCAGGCTAAGAAACCATGTCCTGTAAACTTCGAGTTCATGAACTACACAATCATCACCAGTCGTTGCAAAGGTCCACGCTACCCCGCTAACCTCTGTTGTCAAGCATTCAAAGACTTCGCGTGCCCTTACTCACAAGAGTT...

Protein

Download Protein FASTA

186 aa · TkA04G262950|TK1151|PROTEIN

MKIAIFVLLVLCCISICFSSPVSVSDGVFAAEASIGRNLLQAKKPCPVNFEFMNYTIITSRCKGPRYPANLCCQAFKDFACPYSQELNDLENECSSTMFSYINLYGGYPPGLFASLCRDDKVGLICPALAPGTGKNGVGADSNNSYSIHSPLLPLVISAVCFILLFRWFERSNFRLFMLPISFKFV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G262950`
TK1151 ID	TkA04G262950
OH-1004 ID	LXL04_037238
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 90.860 / OH-1004 51.682 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G262950

Location Chr04:66490735-66492355 (-)

Description Similar to NPF3.1: Protein NRT1/ PTR FAMILY 3.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56170`	Component of the FER-regulated Rho GTPase signaling complex.	Glycosylphosphatidylinositol-anchored proteins as chaperones and co-receptors for FERONIA receptor kinase signaling in Arabidopsis.2015 · DOI: 10.7554/elife.06587
`At4g26466`	Female gametophyte-specific component of the signaling pathway required for fertilization.	No verified direct reference in this release
`At2g20700`	GPI-anchored protein LLG2.	No verified direct reference in this release
`At4g28280`	GPI-anchored protein LLG3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037238 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010198 synergid death Biological Process

GO:0010336 gibberellic acid homeostasis Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0045927 positive regulation of growth Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0072659 protein localization to plasma membrane Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:1903427 negative regulation of reactive oxygen species biosynthetic process Biological Process

GO:1903428 positive regulation of reactive oxygen species biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT1G68570

ath:AT2G20700

ath:AT4G26466

ath:AT4G28280

ath:AT5G56170

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.503

Rank 1 · TkA04G262950 · TK1151

Endoplasmic reticulum0.159

Rank 2 · TkA04G262950 · TK1151

Lysosome / Vacuole0.137

Rank 3 · TkA04G262950 · TK1151

Cytoplasm0.123

Rank 4 · TkA04G262950 · TK1151

Extracellular0.113

Rank 5 · TkA04G262950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26578LLG148-124 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G262950	`PF26578`	LLG1	48	124	1e-38	131.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKT1`	Arabidopsis thaliana	sp\|Q9FKT1\|LLG1_ARATH GPI-anchored protein LLG1	59.600%	Swiss-Prot	High
`B3GS44`	Arabidopsis thaliana	sp\|B3GS44\|LRE_ARATH GPI-anchored protein LORELEI	59.100%	Swiss-Prot	Medium
`Q6NLF4`	Arabidopsis thaliana	sp\|Q6NLF4\|LLG2_ARATH GPI-anchored protein LLG2	59.800%	Swiss-Prot	Medium
`Q9M0I0`	Arabidopsis thaliana	sp\|Q9M0I0\|LLG3_ARATH GPI-anchored protein LLG3	56.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card