LXL04_037238 | RubberDandelionOmics

Gene overview

LXL04_037238

Reference: OH-1004 Chr: Chr09 Coordinates: 3860795-3862912 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1036 bp · LXL04_037238|LXL04_037238|OH1004|cDNA

ATGAACCGAACCCTAACGAAATCATTCCAAATCCCAGCTGGATCCATGACTGTTTTCACCTTAACCTCATTGCTAACCACAATCGTCTTCTACGATCGTGTGTTCGTGCCCATCGCACGTAAACTCACAAGGCTAGAACGGGGAATTTCGTTTCTTACCAGAATGGGAATCGGGTTTTGCATATCGGTTCTCGCCACATTGGTCGCCAGATTCATTGAAAGAAAGCGCAAGAAGGCCGCGTTTGACAATAATCTGATAGA...

CDS

Download CDS FASTA

984 bp · LXL04_037238|LXL04_037238|OH1004|CDS

ATGAACCGAACCCTAACGAAATCATTCCAAATCCCAGCTGGATCCATGACTGTTTTCACCTTAACCTCATTGCTAACCACAATCGTCTTCTACGATCGTGTGTTCGTGCCCATCGCACGTAAACTCACAAGGCTAGAACGGGGAATTTCGTTTCTTACCAGAATGGGAATCGGGTTTTGCATATCGGTTCTCGCCACATTGGTCGCCAGATTCATTGAAAGAAAGCGCAAGAAGGCCGCGTTTGACAATAATCTGATAGA...

Protein

Download Protein FASTA

327 aa · LXL04_037238|LXL04_037238|OH1004|PROTEIN

MNRTLTKSFQIPAGSMTVFTLTSLLTTIVFYDRVFVPIARKLTRLERGISFLTRMGIGFCISVLATLVARFIERKRKKAAFDNNLIDKPHETIPITAPESMRSTAIGVFWMAIADGNYFSTLMVTMVHKLMCFGWRFHDDYLLKPVNRRNLTTADSSSMKIAIFVLLVLCCISICFSSPVSVSDGVFAAEASIGRNLLQAKKPCPVNFEFMNYTIITSRCKGPRYPANLCCQAFKDFACPYSQDLNDLENECSSTMFSYI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037238`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037238

Location Chr09:3860795-3862912 (-)

Description Similar to NPF3.1: Protein NRT1/ PTR FAMILY 3.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68570`	May act as an efflux-type nitrite transporter.	A nitrite transporter associated with nitrite uptake by higher plant chloroplasts.2007 · DOI: 10.1093/pcp/pcm073
`At5g56170`	Component of the FER-regulated Rho GTPase signaling complex.	Glycosylphosphatidylinositol-anchored proteins as chaperones and co-receptors for FERONIA receptor kinase signaling in Arabidopsis.2015 · DOI: 10.7554/elife.06587
`At4g26466`	Female gametophyte-specific component of the signaling pathway required for fertilization.	No verified direct reference in this release
`At4g28280`	GPI-anchored protein LLG3.	No verified direct reference in this release
`At2g20700`	GPI-anchored protein LLG2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037238 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010198 synergid death Biological Process

GO:0010336 gibberellic acid homeostasis Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0045927 positive regulation of growth Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0072659 protein localization to plasma membrane Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:1903427 negative regulation of reactive oxygen species biosynthetic process Biological Process

GO:1903428 positive regulation of reactive oxygen species biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT1G68570

ath:AT2G20700

ath:AT4G26466

ath:AT4G28280

ath:AT5G56170

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.674

Rank 1 · LXL04_037238 · OH-1004

Lysosome / Vacuole0.128

Rank 2 · LXL04_037238 · OH-1004

Endoplasmic reticulum0.116

Rank 3 · LXL04_037238 · OH-1004

Cytoplasm0.079

Rank 4 · LXL04_037238 · OH-1004

Golgi apparatus0.039

Rank 5 · LXL04_037238 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00854.28PTR21-80 aa

PF26578.1LLG1206-282 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037238	`PF00854.28`	PTR2	1	80	6.1e-15	55.7
LXL04_037238	`PF26578.1`	LLG1	206	282	5e-38	129.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SX20`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 3.1	56.962%	Swiss-Prot	weak database homology
`Q9FKT1`	Arabidopsis thaliana	GPI-anchored protein LLG1	57.823%	Swiss-Prot	weak database homology
`B3GS44`	Arabidopsis thaliana	GPI-anchored protein LORELEI	59.223%	Swiss-Prot	weak database homology
`Q9M0I0`	Arabidopsis thaliana	GPI-anchored protein LLG3	53.333%	Swiss-Prot	weak database homology
`Q6NLF4`	Arabidopsis thaliana	GPI-anchored protein LLG2	59.813%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card