TkA04G260260 | RubberDandelionOmics

Gene overview

TkA04G260260

Reference: TK1151 Chr: Chr04 Coordinates: 65810098-65812034 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1349 bp · TkA04G260260|TK1151|cDNA

TTTTTTTGTCATTTGACAAATATAAAGTCTTTTACCACCATTGGTTTAGATAACCTATTAACAGAATTCAGTCAAGTGACTTCATTCAGAGAGATCAAACAGATGAATCTTACAAGCTTGGCGCGAGTCTCCTTTCTCTCAACTTCATTCACATCAAGAACACTCAATCGCTCCCTTGCTTACAGACCTATTTCTTGTTCATCACTTTCCCATACACCCACTTCACTAAACCCTAACCTCCCACTATTTCTCCGACCACC...

CDS

Download CDS FASTA

1194 bp · TkA04G260260|TK1151|CDS

TTTTTTTGTCATTTGACAAATATAAAGTCTTTTACCACCATTGGTTTAGATAACCTATTAACAGAATTCAGTCAAGTGACTTCATTCAGAGAGATCAAACAGATGAATCTTACAAGCTTGGCGCGAGTCTCCTTTCTCTCAACTTCATTCACATCAAGAACACTCAATCGCTCCCTTGCTTACAGACCTATTTCTTGTTCATCACTTTCCCATACACCCACTTCACTAAACCCTAACCTCCCACTATTTCTCCGACCACC...

Protein

Download Protein FASTA

397 aa · TkA04G260260|TK1151|PROTEIN

FFCHLTNIKSFTTIGLDNLLTEFSQVTSFREIKQMNLTSLARVSFLSTSFTSRTLNRSLAYRPISCSSLSHTPTSLNPNLPLFLRPPTFTATVSDLKKWQNWAKSLALSVGSSFADSDNGPDSDILHRELNWLIEDTLESPKSLLLSEHDAVLTLRAELGDLYSLWKQRIEKRRPFQYIVGCEHWRDLVLSVEEGVLIPRPETELIIDLVDDAIKQNVELKNGMWVDLGTGSGAIAIGIGRILGDSVRVTAIDLSPIAVQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G260260`
TK1151 ID	TkA04G260260
OH-1004 ID	LXL04_037218
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.000
Protein coverage (%)	TK1151 98.992 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G260260`
Location	Chr04:65810098-65812034 (+)
Description	Similar to prmC: Release factor glutamine methyltransferase (Thermosynechococcus elongatus (strain BP-1)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037218` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006415 translational termination Biological Process GO:0032259 methylation Biological Process GO:0003676 nucleic acid binding Molecular Function GO:0036009 protein-glutamine N-methyltransferase activity Molecular Function GO:0102559 peptide chain release factor N(5)-glutamine methyltransferase activity Molecular Function
KEGG gene cross-reference	gvi:glr1755 mta:Moth_2396 pma:Pro_0359 syn:sll1237 tel:tlr1836 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.760

Rank 1 · TkA04G260260 · TK1151

Mitochondrion0.270

Rank 2 · TkA04G260260 · TK1151

Cytoplasm0.058

Rank 3 · TkA04G260260 · TK1151

Nucleus0.047

Rank 4 · TkA04G260260 · TK1151

Peroxisome0.016

Rank 5 · TkA04G260260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10294Methyltransf_16119-133 aa

PF17827PrmC_N128-181 aa

PF00891Methyltransf_2174-286 aa

PF03602Cons_hypoth95187-315 aa

PF06325PrmA203-299 aa

PF01135PCMT214-280 aa

PF12847Methyltransf_18214-290 aa

PF10294Methyltransf_16216-287 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G260260	`PF10294`	Methyltransf_16	119	133	0.0048	17.4
TkA04G260260	`PF17827`	PrmC_N	128	181	0.07	14.5
TkA04G260260	`PF00891`	Methyltransf_2	174	286	0.022	14.8
TkA04G260260	`PF03602`	Cons_hypoth95	187	315	0.00095	19.6
TkA04G260260	`PF06325`	PrmA	203	299	2.4e-07	31.3
TkA04G260260	`PF01135`	PCMT	214	280	0.005	17.4
TkA04G260260	`PF12847`	Methyltransf_18	214	290	0.027	15.2
TkA04G260260	`PF10294`	Methyltransf_16	216	287	0.0048	17.4
TkA04G260260	`PF13489`	Methyltransf_23	218	274	0.0082	16.6
TkA04G260260	`PF05175`	MTS	221	303	5.5e-08	33.3
TkA04G260260	`PF02475`	TRM5-TYW2_MTfase	221	279	0.065	13.9
TkA04G260260	`PF30636`	Methyltransf_37	224	281	0.2	12.3
TkA04G260260	`PF13847`	Methyltransf_31	225	299	4.9e-06	27.1
TkA04G260260	`PF09445`	Methyltransf_15	225	290	0.00048	20.5
TkA04G260260	`PF13649`	Methyltransf_25	226	310	3.3e-05	25.2
TkA04G260260	`PF08242`	Methyltransf_12	226	273	0.033	15.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card