TkA04G255780 | RubberDandelionOmics

Gene overview

TkA04G255780

Reference: TK1151 Chr: Chr04 Coordinates: 64694671-64695345 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

477 bp · TkA04G255780|TK1151|cDNA

ATGGGATCAATGTACGCCGCAACCCTCTTCCTCGGAGTTCAAAACGCATTGGCGGTGCAACCGGTAGTAGATGTAGAGCGTACTGTATTTTACAGAGAACGAGCTGCAGGAATATACTCCGCTTTGCCATACGCTTTTGCTCAAGTTTTGGTTGAAATCCCTTACGTTTTTTCACAGAGCGGGGTGTACAGTCTAGTTGTGTATGCTATGATTGGGTTCGAATGGACAACAGCCAAGTTCTTCTGGTACTTCTTCTTCGA...

CDS

Download CDS FASTA

477 bp · TkA04G255780|TK1151|CDS

ATGGGATCAATGTACGCCGCAACCCTCTTCCTCGGAGTTCAAAACGCATTGGCGGTGCAACCGGTAGTAGATGTAGAGCGTACTGTATTTTACAGAGAACGAGCTGCAGGAATATACTCCGCTTTGCCATACGCTTTTGCTCAAGTTTTGGTTGAAATCCCTTACGTTTTTTCACAGAGCGGGGTGTACAGTCTAGTTGTGTATGCTATGATTGGGTTCGAATGGACAACAGCCAAGTTCTTCTGGTACTTCTTCTTCGA...

Protein

Download Protein FASTA

158 aa · TkA04G255780|TK1151|PROTEIN

MGSMYAATLFLGVQNALAVQPVVDVERTVFYRERAAGIYSALPYAFAQVLVEIPYVFSQSGVYSLVVYAMIGFEWTTAKFFWYFFFEFCCLLYMTYYGMMTVAITPNANIAAIIASSFFALFNLFSGFIIPRPRIPVWWRWSFMERKNSNDMNRLFRV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G255780`
TK1151 ID	TkA04G255780
OH-1004 ID	LXL04_037182
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 52.492 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G255780

Location Chr04:64694671-64695345 (+)

Description Similar to PDR1: Pleiotropic drug resistance protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15520`	May participate in transmembrane ABA import and associated signaling.	PDR-type ABC transporter mediates cellular uptake of the phytohormone abscisic acid.2010 · DOI: 10.1073/pnas.0909222107 ABA transport factors found in Arabidopsis ABC transporters.2010 · DOI: 10.4161/psb.5.9.12566 Arabidopsis Lectin Receptor Kinases LecRK-IX.1 and LecRK-IX.2 Are Functional Analogs in Regulating Phytophthora Resistance and Plant Cell Death.2015 · DOI: 10.1094/mpmi-02-15-0025-r Abscisic acid transporters cooperate to control seed germination.2015 · DOI: 10.1038/ncomms9113

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2WSH0`	May be a general defense protein.	No verified direct reference in this release
`Os01g0609300`	May be a general defense protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037182 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009914 hormone transport Biological Process

GO:0010193 response to ozone Biological Process

GO:0010496 intercellular transport Biological Process

KEGG gene cross-reference

ath:AT1G15520

nta:107799533

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.289

Rank 1 · TkA04G255780 · TK1151

Endoplasmic reticulum0.263

Rank 2 · TkA04G255780 · TK1151

Cell membrane0.258

Rank 3 · TkA04G255780 · TK1151

Golgi apparatus0.120

Rank 4 · TkA04G255780 · TK1151

Cytoplasm0.081

Rank 5 · TkA04G255780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01061ABC2_membrane1-141 aa

PF12698ABC2_membrane_340-143 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G255780	`PF01061`	ABC2_membrane	1	141	2.2e-39	135.9
TkA04G255780	`PF12698`	ABC2_membrane_3	40	143	1.9	8.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9E1`	Arabidopsis thaliana	sp\|Q9M9E1\|AB40G_ARATH ABC transporter G family member 40	67.100%	Swiss-Prot	High
`A2WSH0`	Oryza sativa subsp. indica	sp\|A2WSH0\|AB36G_ORYSI ABC transporter G family member 36	69.500%	Swiss-Prot	High
`Q0JLC5`	Oryza sativa subsp. japonica	sp\|Q0JLC5\|AB36G_ORYSJ ABC transporter G family member 36	69.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card