TkA04G235600 | RubberDandelionOmics

Gene overview

TkA04G235600

Reference: TK1151 Chr: Chr04 Coordinates: 59855072-59860512 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2884 bp · TkA04G235600|TK1151|cDNA

TTAACGTATCTAATTTTCATCGTTTTTGGATTTGGGGTTTTGCTTAAACCCCAATTTCGATTCTTCGGTCGCGAAATCCCCGCCATTGACAGGACTATCAAGACAACAATTTAACTTAATTTCAATTAATGGGGAAGAAGAAACAGAAGCAGAAGGTGGTACTACCACCAGAGCTTCCACCAGATGTACCTGAAGATGAAATTGAAGTTTCAGATGAGGACATGGACTTTGTCAATAAAAACCAGGAGTATGCTGGATTT...

CDS

Download CDS FASTA

2448 bp · TkA04G235600|TK1151|CDS

ATGGGGAAGAAGAAACAGAAGCAGAAGGTGGTACTACCACCAGAGCTTCCACCAGATGTACCTGAAGATGAAATTGAAGTTTCAGATGAGGACATGGACTTTGTCAATAAAAACCAGGAGTATGCTGGATTTGTATCAAAGTTGGATACCCAATCAATTACCAGACATATCAACCGTGTTGCTGATGTGAAAGAAGATGCACTGGAGTCTTTGTATGAAAAAAGATCAAGGAAAAAAGCTTTATCTACTGACAATGTTAT...

Protein

Download Protein FASTA

815 aa · TkA04G235600|TK1151|PROTEIN

MGKKKQKQKVVLPPELPPDVPEDEIEVSDEDMDFVNKNQEYAGFVSKLDTQSITRHINRVADVKEDALESLYEKRSRKKALSTDNVIQHEVDPVDALPVKTLDGEVYYRKVSKGPSKFEKAKNEDETVGENDDIARDNGVVKLTKAEKRAKFKKLRKEAKKQGTAVPSDLEEVEQNTQAEVLAEVEKDLSVEEANEKKKFRLAELGTLMLTDPEGNIKNLKEMLQISRDGDQSISILGLKSLLAVFKDIIPGNRIRLPTD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G235600`
TK1151 ID	TkA04G235600
OH-1004 ID	LXL04_039323
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	97.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G235600

Location Chr04:59855072-59860512 (+)

Description Similar to noc3l: Nucleolar complex protein 3 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79150`	May be required for synthesis of 60S ribosomal subunits and the transport of pre-ribosomes from the nucleoplasm to the cytoplasm (By similarity).	Genome-wide analysis of the core DNA replication machinery in the higher plants Arabidopsis and rice.2007 · DOI: 10.1104/pp.107.101105

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039323 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006270 DNA replication initiation Biological Process

GO:0019216 regulation of lipid metabolic process Biological Process

GO:0042254 ribosome biogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0016607 nuclear speck Cellular Component

GO:0003682 chromatin binding Molecular Function

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G79150

cge:100689254

dre:321289

hsa:64318

mmu:57753

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.956

Rank 1 · TkA04G235600 · TK1151

Cytoplasm0.106

Rank 2 · TkA04G235600 · TK1151

Cell membrane0.018

Rank 3 · TkA04G235600 · TK1151

Mitochondrion0.014

Rank 4 · TkA04G235600 · TK1151

Endoplasmic reticulum0.010

Rank 5 · TkA04G235600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22594GTP-eEF1A_C140-199 aa

PF24036DUF7345141-210 aa

PF28337NNF2_middle146-173 aa

PF07540NOC3p198-274 aa

PF07540NOC3p291-339 aa

PF03914CBF354-375 aa

PF24036DUF7345403-439 aa

PF28337NNF2_middle404-415 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G235600	`PF22594`	GTP-eEF1A_C	140	199	0.14	13.3
TkA04G235600	`PF24036`	DUF7345	141	210	4.6	8.2
TkA04G235600	`PF28337`	NNF2_middle	146	173	2.5	8.5
TkA04G235600	`PF07540`	NOC3p	198	274	5.4e-18	65.9
TkA04G235600	`PF07540`	NOC3p	291	339	5.4e-18	65.9
TkA04G235600	`PF03914`	CBF	354	375	6.4e-24	85.5
TkA04G235600	`PF24036`	DUF7345	403	439	4.6	8.2
TkA04G235600	`PF28337`	NNF2_middle	404	415	2.5	8.5
TkA04G235600	`PF03914`	CBF	553	701	6.4e-24	85.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IDJ0`	Arabidopsis thaliana	sp\|F4IDJ0\|NOC3_ARATH Nucleolar complex-associated protein 3	54.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card