LXL04_039323 | RubberDandelionOmics

Gene overview

LXL04_039323

Reference: OH-1004 Chr: JAJTUU010000010.1 Coordinates: 2753996-2758585 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2508 bp · LXL04_039323|LXL04_039323|OH1004|cDNA

ATGGGGAAGAAGAAACAGAAGCAGAAGGTGGTACTACCACCAGAGCTTCCACCAGATGTACCTGAAGATGAAATTGAAGTTTCAGATGAGGACATGGACTTTGTCAATAAAAACCAGGAGTATGCTGGATTTGTATCAAAGTTGGATACCCAATCAATTACCAGACATATCAACCGTGTTGCTGATGTGAAAGAAGATGCACTGGAGTCTTTGTATGAAAAAAGATCAAGGAAAAAAGCTTTATCTACTGACAATGTTAT...

CDS

Download CDS FASTA

2508 bp · LXL04_039323|LXL04_039323|OH1004|CDS

ATGGGGAAGAAGAAACAGAAGCAGAAGGTGGTACTACCACCAGAGCTTCCACCAGATGTACCTGAAGATGAAATTGAAGTTTCAGATGAGGACATGGACTTTGTCAATAAAAACCAGGAGTATGCTGGATTTGTATCAAAGTTGGATACCCAATCAATTACCAGACATATCAACCGTGTTGCTGATGTGAAAGAAGATGCACTGGAGTCTTTGTATGAAAAAAGATCAAGGAAAAAAGCTTTATCTACTGACAATGTTAT...

Protein

Download Protein FASTA

835 aa · LXL04_039323|LXL04_039323|OH1004|PROTEIN

MGKKKQKQKVVLPPELPPDVPEDEIEVSDEDMDFVNKNQEYAGFVSKLDTQSITRHINRVADVKEDALESLYEKRSRKKALSTDNVIQHEVDPVDALPVKTLDGEVYYRKVSKGPSKFEKAKNEDETVGENDDIARDNGVVKLTKAEKRAKFKKLRKEAKKQGTAVPSDLEEVEQNTQAEVLAEVEKDLSVEEANEKKKFRLAELGTLMLTDPEGNIKNLKEMLQISRDGDQSISILGLKSLLAVFKDIIPGNRIRLPTD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039323`
TK1151 ID	TkA04G235600
OH-1004 ID	LXL04_039323
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	97.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039323

Location JAJTUU010000010.1:2753996-2758585 (-)

Description Similar to noc3l: Nucleolar complex protein 3 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79150`	May be required for synthesis of 60S ribosomal subunits and the transport of pre-ribosomes from the nucleoplasm to the cytoplasm (By similarity).	Genome-wide analysis of the core DNA replication machinery in the higher plants Arabidopsis and rice.2007 · DOI: 10.1104/pp.107.101105

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039323 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006270 DNA replication initiation Biological Process

GO:0019216 regulation of lipid metabolic process Biological Process

GO:0042254 ribosome biogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0016607 nuclear speck Cellular Component

GO:0003682 chromatin binding Molecular Function

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G79150

cge:100689254

dre:321289

hsa:64318

mmu:57753

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.957

Rank 1 · LXL04_039323 · OH-1004

Cytoplasm0.104

Rank 2 · LXL04_039323 · OH-1004

Cell membrane0.017

Rank 3 · LXL04_039323 · OH-1004

Mitochondrion0.013

Rank 4 · LXL04_039323 · OH-1004

Endoplasmic reticulum0.010

Rank 5 · LXL04_039323 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07540.17NOC3p198-288 aa

PF03914.24CBF566-721 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039323	`PF07540.17`	NOC3p	198	288	2.1e-24	86.5
LXL04_039323	`PF03914.24`	CBF	566	721	1.3e-27	97.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IDJ0`	Arabidopsis thaliana	Nucleolar complex-associated protein 3	54.897%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card