TkA04G230760 | RubberDandelionOmics

Gene overview

TkA04G230760

Reference: TK1151 Chr: Chr04 Coordinates: 58615095-58620606 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4024 bp · TkA04G230760|TK1151|cDNA

TTTTTCCTTCCAAGAGAAAAACAACAAGGCCTACGGCCACACCTTCCTTCCTCCTCTCCAGCCGACGGCAGCCTCCTCCACCGACGGCCAAGATCCGTCGCCTCTCCTCCGCTCGACGCATCTCCTCCATGGGTAAGCTTTCAATCAATAAATTCCCGATTACTACTACGCTAAAATCGATTCTTAAAATCGAAATCCAAAATCGATTTCTCCTTTATCCCGTTTTCCTCAACTGCTTTTCAATCATCCAATTCAGAAGT...

CDS

Download CDS FASTA

1827 bp · TkA04G230760|TK1151|CDS

ATGGATTCTTCCTCTTTCGAAGGGTTTGTGCTTGATCCATCATCAAATTGCAGTAAATTAAGCATGGAAGAAAAAAGAGAAATCGTATACGAAGTATCCGAATGGTCACACGGAGCACCCGAGCTCCTACAATCTTGGAGCCGTCAAGAAATTCTTCAAATCCTATGTTCCGAAATGGGAAAAGAACGAAAGTACACGGGTCTCACAAAATTAAAAATCATCGAACATCTTCTCAAAATCGTATCCGAAAAAAAATCAAA...

Protein

Download Protein FASTA

608 aa · TkA04G230760|TK1151|PROTEIN

MDSSSFEGFVLDPSSNCSKLSMEEKREIVYEVSEWSHGAPELLQSWSRQEILQILCSEMGKERKYTGLTKLKIIEHLLKIVSEKKSNNLEYEHDMISNIESSENGGPTKRHRKSDHPNRLFNSTDNHNSSVNVVDLDVVEFCKNSACRAKLGEDGGFCKRCSCCICRRFDDNKDPSLWLVCSSDPPFLGGSCGMSCHLECALRHDKSGIVTKDRGLDGSFFCVSCGKMNDLLGCWRKQMMIARDTRRVDILCYRVSLSQK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G230760`
TK1151 ID	TkA04G230760
OH-1004 ID	LXL04_039343
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G230760

Location Chr04:58615095-58620606 (-)

Description Similar to VIL2: VIN3-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30200`	Maybe involved in both the vernalization and photoperiod pathways by regulating gene expression.	The Plant Homeo Domain finger protein, VIN3-LIKE 2, is necessary for photoperiod-mediated epigenetic regulation of the floral repressor, MAF5.2010 · DOI: 10.1073/pnas.1010834107
`At5g57380`	Plays a central role in vernalization by mediating the initial transcriptional repression of the homeotic gene FLC, a floral repressor, after a cold treatment.	Vernalization in Arabidopsis thaliana is mediated by the PHD finger protein VIN3.2004 · DOI: 10.1038/nature02195 A PHD finger protein involved in both the vernalization and photoperiod pathways in Arabidopsis.2006 · DOI: 10.1101/gad.1493306 The PHD finger protein VRN5 functions in the epigenetic silencing of Arabidopsis FLC.2007 · DOI: 10.1016/j.cub.2006.11.052
`At2g18880`	Involved in both the vernalization and photoperiod pathways by regulating gene expression.	No verified direct reference in this release
`At3g24440`	Involved in both the vernalization and photoperiod pathways by regulating expression of the related floral repressors FLOWERING LOCUS C (FLC) and FLOWERING LOCUS M (FLM).	A PHD finger protein involved in both the vernalization and photoperiod pathways in Arabidopsis.2006 · DOI: 10.1101/gad.1493306 The PHD finger protein VRN5 functions in the epigenetic silencing of Arabidopsis FLC.2007 · DOI: 10.1016/j.cub.2006.11.052 A PHD-polycomb repressive complex 2 triggers the epigenetic silencing of FLC during vernalization.2008 · DOI: 10.1073/pnas.0808687105

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039343 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009908 flower development Biological Process

GO:0010048 vernalization response Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0032922 circadian regulation of gene expression Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0045814 negative regulation of gene expression, epigenetic Biological Process

GO:0048572 short-day photoperiodism Biological Process

GO:0048575 short-day photoperiodism, flowering Biological Process

GO:0048587 regulation of short-day photoperiodism, flowering Biological Process

KEGG gene cross-reference

ath:AT2G18880

ath:AT3G24440

ath:AT4G30200

ath:AT5G57380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.950

Rank 1 · TkA04G230760 · TK1151

Cytoplasm0.096

Rank 2 · TkA04G230760 · TK1151

Cell membrane0.036

Rank 3 · TkA04G230760 · TK1151

Endoplasmic reticulum0.022

Rank 4 · TkA04G230760 · TK1151

Plastid0.016

Rank 5 · TkA04G230760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30718HEAT_Spiral_Tel158-142 aa

PF23376Fn3_VIN375-90 aa

PF07227PHD_Oberon142-260 aa

PF23376Fn3_VIN3344-429 aa

PF30718HEAT_Spiral_Tel1395-437 aa

PF23380VIN3_C522-594 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G230760	`PF30718`	HEAT_Spiral_Tel1	58	142	0.043	12.5
TkA04G230760	`PF23376`	Fn3_VIN3	75	90	7.3e-15	55.6
TkA04G230760	`PF07227`	PHD_Oberon	142	260	6.2e-34	117.4
TkA04G230760	`PF23376`	Fn3_VIN3	344	429	7.3e-15	55.6
TkA04G230760	`PF30718`	HEAT_Spiral_Tel1	395	437	0.043	12.5
TkA04G230760	`PF23380`	VIN3_C	522	594	1.2e-35	121.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SUM4`	Arabidopsis thaliana	sp\|Q9SUM4\|VIL2_ARATH VIN3-like protein 2	41.800%	Swiss-Prot	Medium
`Q9FIE3`	Arabidopsis thaliana	sp\|Q9FIE3\|VIN3_ARATH Protein VERNALIZATION INSENSITIVE 3	39.700%	Swiss-Prot	Medium
`Q5BPT4`	Arabidopsis thaliana	sp\|Q5BPT4\|VIL3_ARATH VIN3-like protein 3	33.900%	Swiss-Prot	Medium
`Q9LHF5`	Arabidopsis thaliana	sp\|Q9LHF5\|VIL1_ARATH VIN3-like protein 1	30.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card