TkA04G201940 | RubberDandelionOmics

Gene overview

TkA04G201940

Reference: TK1151 Chr: Chr04 Coordinates: 51916866-51917292 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

360 bp · TkA04G201940|TK1151|cDNA

ATGGAGGAGCCTAATTGGGGGCTAAACCTAAGGATTTGCGCCATGATTAACAGTGAAGAGTTCAACGGAACGGAAATCGTGAAAGCGATTAAGAAGAAGATTGGGTCGGGTAAGAGCGCGATTAATCAGCGGCTGAGCCTTGATTTGTTGGAGATGTGTACGTCGAACTGCGATAAGGTGTTCTCGGAGGTCGCGTCGGAGAAAGTGCTTGAGGATATGGTTGCGATGGTTCAGGATGTTCGGACTGATGAACGGAATAG...

CDS

Download CDS FASTA

360 bp · TkA04G201940|TK1151|CDS

ATGGAGGAGCCTAATTGGGGGCTAAACCTAAGGATTTGCGCCATGATTAACAGTGAAGAGTTCAACGGAACGGAAATCGTGAAAGCGATTAAGAAGAAGATTGGGTCGGGTAAGAGCGCGATTAATCAGCGGCTGAGCCTTGATTTGTTGGAGATGTGTACGTCGAACTGCGATAAGGTGTTCTCGGAGGTCGCGTCGGAGAAAGTGCTTGAGGATATGGTTGCGATGGTTCAGGATGTTCGGACTGATGAACGGAATAG...

Protein

Download Protein FASTA

119 aa · TkA04G201940|TK1151|PROTEIN

MEEPNWGLNLRICAMINSEEFNGTEIVKAIKKKIGSGKSAINQRLSLDLLEMCTSNCDKVFSEVASEKVLEDMVAMVQDVRTDERNRTKAVQLIRAWGESEELMYLPVFRQTHLEAMWL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G201940`
TK1151 ID	TkA04G201940
OH-1004 ID	LXL04_035441
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	49.100
Protein coverage (%)	TK1151 94.958 / OH-1004 26.218 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G201940

Location Chr04:51916866-51917292 (+)

Description Similar to TOL1: TOM1-like protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06210`	Binds ubiquitin in vitro.	No verified direct reference in this release
`At5g16880`	Might contribute to the loading of the ESCRT machinery.	No verified direct reference in this release
`At4g32760`	Might contribute to the loading of the ESCRT machinery.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035441 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0043328 protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0035091 phosphatidylinositol binding Molecular Function

GO:0043130 ubiquitin binding Molecular Function

KEGG gene cross-reference

ath:AT1G06210

ath:AT1G21380

ath:AT1G76970

ath:AT4G32760

ath:AT5G16880

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.574

Rank 1 · TkA04G201940 · TK1151

Nucleus0.373

Rank 2 · TkA04G201940 · TK1151

Cell membrane0.142

Rank 3 · TkA04G201940 · TK1151

Golgi apparatus0.079

Rank 4 · TkA04G201940 · TK1151

Mitochondrion0.073

Rank 5 · TkA04G201940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00790VHS2-99 aa

PF27287YomO9-45 aa

PF28366GAMMACA1_C11-34 aa

PF11841ELMO_ARM26-96 aa

PF13238AAA_1834-99 aa

PF28366GAMMACA1_C48-71 aa

PF27287YomO54-90 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G201940	`PF00790`	VHS	2	99	1.5e-16	61.2
TkA04G201940	`PF27287`	YomO	9	45	0.019	15.4
TkA04G201940	`PF28366`	GAMMACA1_C	11	34	0.005	17.5
TkA04G201940	`PF11841`	ELMO_ARM	26	96	0.0042	17.7
TkA04G201940	`PF13238`	AAA_18	34	99	0.055	14.7
TkA04G201940	`PF28366`	GAMMACA1_C	48	71	0.005	17.5
TkA04G201940	`PF27287`	YomO	54	90	0.019	15.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LNC6`	Arabidopsis thaliana	sp\|Q9LNC6\|TOL2_ARATH TOM1-like protein 2	65.800%	Swiss-Prot	High
`Q9LFL3`	Arabidopsis thaliana	sp\|Q9LFL3\|TOL1_ARATH TOM1-like protein 1	52.600%	Swiss-Prot	High
`Q8L860`	Arabidopsis thaliana	sp\|Q8L860\|TOL9_ARATH TOM1-like protein 9	39.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card