TkA04G175030 | RubberDandelionOmics

Gene overview

TkA04G175030

Reference: TK1151 Chr: Chr04 Coordinates: 45324054-45325003 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

693 bp · TkA04G175030|TK1151|cDNA

ATGGGTTCTCCGTCCTTCCATGAACTTAAAAAGCAAGCTTCTTTTTTCTTGAAAGAAAAAATCAAAAGTGCAAGATTGGTGTTAACAGATGTTACCTCTGCACAACTACTGACTGAAGAAGCAACGGATGAAGATTCATGGCCATCGGACACCCGTACCATGGGATTGATATCACGTGCTGCTTTTGAAGTCGATGATTATTGGAGAATTGTTGATATTCTTCATAAAAGGTTGTGGAAGTTTGATAAAGAGAATTGGAG...

CDS

Download CDS FASTA

693 bp · TkA04G175030|TK1151|CDS

ATGGGTTCTCCGTCCTTCCATGAACTTAAAAAGCAAGCTTCTTTTTTCTTGAAAGAAAAAATCAAAAGTGCAAGATTGGTGTTAACAGATGTTACCTCTGCACAACTACTGACTGAAGAAGCAACGGATGAAGATTCATGGCCATCGGACACCCGTACCATGGGATTGATATCACGTGCTGCTTTTGAAGTCGATGATTATTGGAGAATTGTTGATATTCTTCATAAAAGGTTGTGGAAGTTTGATAAAGAGAATTGGAG...

Protein

Download Protein FASTA

230 aa · TkA04G175030|TK1151|PROTEIN

MGSPSFHELKKQASFFLKEKIKSARLVLTDVTSAQLLTEEATDEDSWPSDTRTMGLISRAAFEVDDYWRIVDILHKRLWKFDKENWRGSYRALVILEHLLTHGPERVSEEFQSDKEVIKEMSMFQHLDEKRFNWGLRVREKSERILKLLDEDLSFLKQERCKARKVTSGIKGFGSCTQISLDKRLEESRSQMYFRCNYNNDGGERNKDLNYPNHAFGDDEHLDRAALLST

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G175030`
TK1151 ID	TkA04G175030
OH-1004 ID	LXL04_035050
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G175030

Location Chr04:45324054-45325003 (-)

Description Similar to SPCC794.11c: ENTH domain-containing protein C794.11c (Schizosaccharomyces pombe (strain 972 / ATCC 24843)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g11710`	May have a role in transport via clathrin-coated vesicles from the trans-Golgi network to endosomes.	Arabidopsis EPSIN1 plays an important role in vacuolar trafficking of soluble cargo proteins in plant cells via interactions with clathrin, AP-1, VTI11, and VSR1.2006 · DOI: 10.1105/tpc.105.039123

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035050 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006895 Golgi to endosome transport Biological Process

GO:0006897 endocytosis Biological Process

GO:0007219 Notch signaling pathway Biological Process

GO:0030036 actin cytoskeleton organization Biological Process

GO:0030100 regulation of endocytosis Biological Process

GO:0042147 retrograde transport, endosome to Golgi Biological Process

GO:0045747 positive regulation of Notch signaling pathway Biological Process

GO:0048268 clathrin coat assembly Biological Process

GO:0090148 membrane fission Biological Process

GO:1905445 positive regulation of clathrin coat assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

KEGG gene cross-reference

hsa:22905

mmu:13855

rno:117277

spo:2539421

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.468

Rank 1 · TkA04G175030 · TK1151

Nucleus0.314

Rank 2 · TkA04G175030 · TK1151

Cell membrane0.214

Rank 3 · TkA04G175030 · TK1151

Plastid0.096

Rank 4 · TkA04G175030 · TK1151

Endoplasmic reticulum0.061

Rank 5 · TkA04G175030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01417ENTH32-152 aa

PF07651ANTH41-162 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G175030	`PF01417`	ENTH	32	152	4.4e-30	105.0
TkA04G175030	`PF07651`	ANTH	41	162	0.0002	21.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VY07`	Arabidopsis thaliana	sp\|Q8VY07\|EPN1_ARATH Clathrin interactor EPSIN 1	25.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card