Gene Card
Gene overview
cDNA / CDS / Protein Sequences
712 bp · LXL04_035050|LXL04_035050|OH1004|cDNA
CAAAAGAAAAAAACATGGGTTCTCCGTCCTTCCATGAACTTAAAAAGCAAGCTTCTTTTTTCTTGAAAGaaaaaatcaaaagtgcaaGATTGGTGTTAACAGATGTTACCTCTGCACAACTACTGACTGAAGAAGCAACGGATGAAGATTCATGGCCATCGGACACCCGTACCATGGGATTGATATCACGTGCTGCTTTTGAAGTCGATGATTATTGGAGAATTGTTGATATTCTTCATAAAAGGTTGTGGAAGTTTGAT...
693 bp · LXL04_035050|LXL04_035050|OH1004|CDS
ATGGGTTCTCCGTCCTTCCATGAACTTAAAAAGCAAGCTTCTTTTTTCTTGAAAGAAAAAATCAAAAGTGCAAGATTGGTGTTAACAGATGTTACCTCTGCACAACTACTGACTGAAGAAGCAACGGATGAAGATTCATGGCCATCGGACACCCGTACCATGGGATTGATATCACGTGCTGCTTTTGAAGTCGATGATTATTGGAGAATTGTTGATATTCTTCATAAAAGGTTGTGGAAGTTTGATAAAGAGAATTGGAG...
Protein
Download Protein FASTA230 aa · LXL04_035050|LXL04_035050|OH1004|PROTEIN
MGSPSFHELKKQASFFLKEKIKSARLVLTDVTSAQLLTEEATDEDSWPSDTRTMGLISRAAFEVDDYWRIVDILHKRLWKFDKENWRGSYRALVILEHLLTHGPERVSEEFQSDKEVIKEMSMFQHLDEKRFNWGLRVREKSERILKLLDEDLSFLKQERCKARKVTSGIKGFGSCTQISLDKRLEESRSQMYFRCNYNNDGGERNKDLNYPNHAFGDDEHLDRAALLST
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_035050 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_035050 |
|---|---|
| Location | Chr08:12325002-12325969 (+) |
| Description | Similar to SPCC794.11c: ENTH domain-containing protein C794.11c (Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006895 Golgi to endosome transport Biological Process GO:0006897 endocytosis Biological Process GO:0007219 Notch signaling pathway Biological Process GO:0030036 actin cytoskeleton organization Biological Process GO:0030100 regulation of endocytosis Biological Process GO:0042147 retrograde transport, endosome to Golgi Biological Process GO:0045747 positive regulation of Notch signaling pathway Biological Process GO:0048268 clathrin coat assembly Biological Process GO:0090148 membrane fission Biological Process GO:1905445 positive regulation of clathrin coat assembly Biological Process GO:0005634 nucleus Cellular Component GO:0005768 endosome Cellular Component |
| KEGG gene cross-reference | hsa:22905 mmu:13855 rno:117277 spo:2539421 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01417.27ENTH32-152 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_035050 | PF01417.27 | ENTH | 32 | 152 | 4.4e-30 | 105.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.