TkA04G167830 | RubberDandelionOmics

Gene overview

TkA04G167830

Reference: TK1151 Chr: Chr04 Coordinates: 43365418-43369774 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3258 bp · TkA04G167830|TK1151|cDNA

GTCACTTCGTTCATACTCATCCAGATCCAAAGTCTTACTTTACTCATTATCGGATTAACAAATACTGTAAGTATTTGAAGTATTTGTTAATCTACTTTCGTCTTATAATTTACTATTTTCACTGTTTCTTACTATGAGATCTGAATTTCGCAACCTCGAATTTTCATATACGCTATGATGTTCGAATTGTGATTATCGGCGTCACTTTATTGACATTTAGGAGTTTAGTTATCGTTACCTAAAATGCAGACGATAGAATT...

CDS

Download CDS FASTA

2247 bp · TkA04G167830|TK1151|CDS

ATGGCATTCAATGGAATCAAAGAAATATTTTCCTCTTTCACAAGTCACTTTTCAACTCCAAAATCTTCTAGTAATGCGTACACATCATCCGGATTACCACCACTAGGCGGCAGTGGTGGAAGTGGCCCTGTTCATGGTTACGGTTTTCCCAATTCTAGACAAAAGAATCTCCTCAGACTCTCCTCCTCCCTCCAAGATTTCTCAGCATACCGCCGCCTCGATCCCGAAGATGGCGGAATTGAAAATATCTCACCAAATCT...

Protein

Download Protein FASTA

748 aa · TkA04G167830|TK1151|PROTEIN

MAFNGIKEIFSSFTSHFSTPKSSSNAYTSSGLPPLGGSGGSGPVHGYGFPNSRQKNLLRLSSSLQDFSAYRRLDPEDGGIENISPNLNQHLRENGGTSFSKEKPPRRKWVRAIMLLFFLLSLASLIYGLLFLYSNWTQSSGRFYVVLDCGSTGTRVYVYQASINHKKTDALPISLKSIPEDLKSKPSSLSGKAYNRMETEPGFDKLVHNVSGLKHAIKPLLLWAEKQIPKRAHKSTCVFLYATAGVRRLPDSDSDWLLKT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G167830`
TK1151 ID	TkA04G167830
OH-1004 ID	LXL04_035102
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.400
Protein coverage (%)	TK1151 99.866 / OH-1004 87.871 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G167830

Location Chr04:43365418-43369774 (+)

Description Similar to APY7: Probable apyrase 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g19180`	Catalyzes the hydrolysis of phosphoanhydride bonds of nucleoside tri- and di-phosphates (By similarity).	No verified direct reference in this release
`At2g02970`	Catalyzes the hydrolysis of phosphoanhydride bonds of nucleoside tri- and di-phosphates (By similarity).	No verified direct reference in this release
`At1g14250`	Catalyzes the hydrolysis of phosphoanhydride bonds of nucleoside tri- and di-phosphates.	No verified direct reference in this release
`At1g14240`	Catalyzes the hydrolysis of phosphoanhydride bonds of nucleoside tri- and di-phosphates.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035102 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009134 nucleoside diphosphate catabolic process Biological Process

GO:0009901 anther dehiscence Biological Process

GO:0010584 pollen exine formation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0030659 cytoplasmic vesicle membrane Cellular Component

GO:0004050 apyrase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0017110 nucleoside diphosphate phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT1G14230

ath:AT1G14240

ath:AT1G14250

ath:AT2G02970

ath:AT4G19180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.551

Rank 1 · TkA04G167830 · TK1151

Cytoplasm0.188

Rank 2 · TkA04G167830 · TK1151

Endoplasmic reticulum0.169

Rank 3 · TkA04G167830 · TK1151

Cell membrane0.145

Rank 4 · TkA04G167830 · TK1151

Lysosome / Vacuole0.112

Rank 5 · TkA04G167830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF285484TM_phosphoesterase99-130 aa

PF01150GDA1_CD39138-573 aa

PF02541Ppx-GppA277-344 aa

PF285484TM_phosphoesterase590-631 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G167830	`PF28548`	4TM_phosphoesterase	99	130	0.07	14.4
TkA04G167830	`PF01150`	GDA1_CD39	138	573	5.7e-57	194.0
TkA04G167830	`PF02541`	Ppx-GppA	277	344	0.019	15.2
TkA04G167830	`PF28548`	4TM_phosphoesterase	590	631	0.07	14.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JSH1`	Arabidopsis thaliana	sp\|F4JSH1\|APY7_ARATH Probable apyrase 7	54.700%	Swiss-Prot	High
`O80612`	Arabidopsis thaliana	sp\|O80612\|APY6_ARATH Probable apyrase 6	26.800%	Swiss-Prot	Low
`Q6NQA8`	Arabidopsis thaliana	sp\|Q6NQA8\|APY5_ARATH Probable apyrase 5	24.400%	Swiss-Prot	Low
`Q9XI62`	Arabidopsis thaliana	sp\|Q9XI62\|APY3_ARATH Probable apyrase 3	25.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card