LXL04_035102 | RubberDandelionOmics

Gene overview

LXL04_035102

Reference: OH-1004 Chr: Chr08 Coordinates: 14490297-14493808 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2427 bp · LXL04_035102|LXL04_035102|OH1004|cDNA

ATGGCATTCAATGGAATCAAAGAAATATTTTCCTCTTTCACAAGTCACTTTTCAACTCCAAAATCTTCTAGTAATGCGTACACATCATCCGGATTACCACCACTAGGCGGCAGTGGTGGAAGTGGCCCTGTTCATGGTTACGGTTTTCCCGGTTCTAGACAAAAGAATCTCCTCAGACTCTCCTCCTCCCTCCAAGATTTCTCAGCATACCGCCGCCTCGATCCCGAAGATGGCGGAATTGAAAATATCTCACCAAATCT...

CDS

Download CDS FASTA

2427 bp · LXL04_035102|LXL04_035102|OH1004|CDS

ATGGCATTCAATGGAATCAAAGAAATATTTTCCTCTTTCACAAGTCACTTTTCAACTCCAAAATCTTCTAGTAATGCGTACACATCATCCGGATTACCACCACTAGGCGGCAGTGGTGGAAGTGGCCCTGTTCATGGTTACGGTTTTCCCGGTTCTAGACAAAAGAATCTCCTCAGACTCTCCTCCTCCCTCCAAGATTTCTCAGCATACCGCCGCCTCGATCCCGAAGATGGCGGAATTGAAAATATCTCACCAAATCT...

Protein

Download Protein FASTA

808 aa · LXL04_035102|LXL04_035102|OH1004|PROTEIN

MAFNGIKEIFSSFTSHFSTPKSSSNAYTSSGLPPLGGSGGSGPVHGYGFPGSRQKNLLRLSSSLQDFSAYRRLDPEDGGIENISPNLNQHLRENGGTSFSKEKPPRRKWVRAIMLLFFLLSLASLIYGLLFLYSNWTQSSGRFYIVLDCGSTGTRVYVYQASINHKKTDALPILLKSIPEDLKSKPSSLSGKAYNRMETEPGFDKLVHNVSGLKHAIKPLLLWAEKQIPKRAHKSTCVFLYATAGVRRLPDSDSDWLLKT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035102`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035102

Location Chr08:14490297-14493808 (-)

Description Similar to APY7: Probable apyrase 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g19180`	Catalyzes the hydrolysis of phosphoanhydride bonds of nucleoside tri- and di-phosphates (By similarity).	No verified direct reference in this release
`At1g14250`	Catalyzes the hydrolysis of phosphoanhydride bonds of nucleoside tri- and di-phosphates.	No verified direct reference in this release
`At1g14230`	Catalyzes the hydrolysis of phosphoanhydride bonds of nucleoside tri- and di-phosphates.	No verified direct reference in this release
`At2g02970`	Catalyzes the hydrolysis of phosphoanhydride bonds of nucleoside tri- and di-phosphates (By similarity).	No verified direct reference in this release
`At1g14240`	Catalyzes the hydrolysis of phosphoanhydride bonds of nucleoside tri- and di-phosphates.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035102 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009134 nucleoside diphosphate catabolic process Biological Process

GO:0009901 anther dehiscence Biological Process

GO:0010584 pollen exine formation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0030659 cytoplasmic vesicle membrane Cellular Component

GO:0004050 apyrase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0017110 nucleoside diphosphate phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT1G14230

ath:AT1G14240

ath:AT1G14250

ath:AT2G02970

ath:AT4G19180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.518

Rank 1 · LXL04_035102 · OH-1004

Endoplasmic reticulum0.215

Rank 2 · LXL04_035102 · OH-1004

Cytoplasm0.134

Rank 3 · LXL04_035102 · OH-1004

Cell membrane0.118

Rank 4 · LXL04_035102 · OH-1004

Lysosome / Vacuole0.102

Rank 5 · LXL04_035102 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01150.24GDA1_CD39138-573 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035102	`PF01150.24`	GDA1_CD39	138	573	2.4e-57	195.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JSH1`	Arabidopsis thaliana	Probable apyrase 7	52.089%	Swiss-Prot	strong database homology
`Q6NQA8`	Arabidopsis thaliana	Probable apyrase 5	24.850%	Swiss-Prot	weak database homology
`Q8H1D8`	Arabidopsis thaliana	Probable apyrase 4	24.603%	Swiss-Prot	weak database homology
`O80612`	Arabidopsis thaliana	Probable apyrase 6	27.354%	Swiss-Prot	weak database homology
`Q9XI62`	Arabidopsis thaliana	Probable apyrase 3	25.207%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card