TkA04G163780 | RubberDandelionOmics

Gene overview

TkA04G163780

Reference: TK1151 Chr: Chr04 Coordinates: 42286024-42286368 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

345 bp · TkA04G163780|TK1151|cDNA

CTTTTCACCAAAGACATCTTAAATCAGAAACAAATTTCCATCTTCGAAGGACCCAATCACGGAACTATCGCTAGGGATTTCACCTACATCGATGATATTGTCAATGGCTATTTATCGTCGATCGATACAGCAAAAAAGAGCACCGGAACTGGAGGGAAGAAGAAGGGTGAAGCTCAATTTAGGATCATCAATTTAGGGAATACTTCCCCTGTTTCAGTTTATAAGTTACTAAACATTCTGGAGAAATTGTTGAAGGTGAA...

CDS

Download CDS FASTA

345 bp · TkA04G163780|TK1151|CDS

CTTTTCACCAAAGACATCTTAAATCAGAAACAAATTTCCATCTTCGAAGGACCCAATCACGGAACTATCGCTAGGGATTTCACCTACATCGATGATATTGTCAATGGCTATTTATCGTCGATCGATACAGCAAAAAAGAGCACCGGAACTGGAGGGAAGAAGAAGGGTGAAGCTCAATTTAGGATCATCAATTTAGGGAATACTTCCCCTGTTTCAGTTTATAAGTTACTAAACATTCTGGAGAAATTGTTGAAGGTGAA...

Protein

Download Protein FASTA

114 aa · TkA04G163780|TK1151|PROTEIN

LFTKDILNQKQISIFEGPNHGTIARDFTYIDDIVNGYLSSIDTAKKSTGTGGKKKGEAQFRIINLGNTSPVSVYKLLNILEKLLKVKARKKMVLMGLRVPPPIGMFRRVPPLVQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G163780`
TK1151 ID	TkA04G163780
OH-1004 ID	LXL04_014409
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	95.700
Protein coverage (%)	TK1151 82.456 / OH-1004 29.375 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G163780

Location Chr04:42286024-42286368 (-)

Description Similar to GAE4: UDP-glucuronate 4-epimerase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02000`	Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components.	No verified direct reference in this release
`At4g12250`	Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components.	No verified direct reference in this release
`At2g45310`	Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components.	No verified direct reference in this release
`At4g00110`	Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components.	No verified direct reference in this release
`At3g23820`	Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components.	Identification and characterization of a UDP-D-glucuronate 4-epimerase in Arabidopsis.2004 · DOI: 10.1016/j.febslet.2004.06.005

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014409 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016020 membrane Cellular Component

GO:0032580 Golgi cisterna membrane Cellular Component

GO:0016854 racemase and epimerase activity Molecular Function

GO:0050378 UDP-glucuronate 4-epimerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G02000

ath:AT2G45310

ath:AT4G00110

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.264

Rank 1 · TkA04G163780 · TK1151

Extracellular0.171

Rank 2 · TkA04G163780 · TK1151

Mitochondrion0.159

Rank 3 · TkA04G163780 · TK1151

Cytoplasm0.101

Rank 4 · TkA04G163780 · TK1151

Lysosome / Vacuole0.070

Rank 5 · TkA04G163780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01370Epimerase4-44 aa

PF02053Gene6642-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G163780	`PF01370`	Epimerase	4	44	0.023	14.8
TkA04G163780	`PF02053`	Gene66	42	109	0.33	11.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LPC1`	Arabidopsis thaliana	sp\|Q9LPC1\|GAE2_ARATH UDP-glucuronate 4-epimerase 2	70.300%	Swiss-Prot	High
`Q9STI6`	Arabidopsis thaliana	sp\|Q9STI6\|GAE5_ARATH UDP-glucuronate 4-epimerase 5	71.100%	Swiss-Prot	High
`O22141`	Arabidopsis thaliana	sp\|O22141\|GAE4_ARATH UDP-glucuronate 4-epimerase 4	68.100%	Swiss-Prot	High
`O81312`	Arabidopsis thaliana	sp\|O81312\|GAE3_ARATH UDP-glucuronate 4-epimerase 3	70.800%	Swiss-Prot	High
`Q9LIS3`	Arabidopsis thaliana	sp\|Q9LIS3\|GAE6_ARATH UDP-glucuronate 4-epimerase 6	58.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card