LXL04_014409 | RubberDandelionOmics

Gene overview

LXL04_014409

Reference: OH-1004 Chr: Chr03 Coordinates: 48581453-48582415 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

963 bp · LXL04_014409|LXL04_014409|OH1004|cDNA

ATGACCCAACTGAAGCCAATTCACTCTCACGTCGATAACATCTCGTCGACCGCCGGAAATTTCAAACCCAACAAATCTTCTCTCTATTACATCCACTATCGTCTCCGGTACCAAACTTCCTTCCCCAATTTTACAATTTGGTCGACCATGTTTCTCTCATTGATTGTTCTGTTCTTCTTCTTATCCCCTCTTGCCACCCCCGCCCCCCTCCGTTGCCTCCGTACAACCAAGTTATCTGCAAAACCCCGCTTCCCGAACTG...

CDS

Download CDS FASTA

963 bp · LXL04_014409|LXL04_014409|OH1004|CDS

ATGACCCAACTGAAGCCAATTCACTCTCACGTCGATAACATCTCGTCGACCGCCGGAAATTTCAAACCCAACAAATCTTCTCTCTATTACATCCACTATCGTCTCCGGTACCAAACTTCCTTCCCCAATTTTACAATTTGGTCGACCATGTTTCTCTCATTGATTGTTCTGTTCTTCTTCTTATCCCCTCTTGCCACCCCCGCCCCCCTCCGTTGCCTCCGTACAACCAAGTTATCTGCAAAACCCCGCTTCCCGAACTG...

Protein

Download Protein FASTA

320 aa · LXL04_014409|LXL04_014409|OH1004|PROTEIN

MTQLKPIHSHVDNISSTAGNFKPNKSSLYYIHYRLRYQTSFPNFTIWSTMFLSLIVLFFFLSPLATPAPLRCLRTTKLSAKPRFPNWSYSGNDVVGLDSKVPFSEKDRTDQSASLCAATKKAGEEIAHAYNHIYGLSITGLRCFTVYGPWGRPDMAYFFFTKDILNRKQISIFEGPNHGTIARDFTYIDDIVNGCLSVIDTAKKSTGTGGKKKGEAQFRIINLGNTSPVSVYKLVNILEKLLKVKARKKMVLMPRNGDVP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014409`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014409

Location Chr03:48581453-48582415 (+)

Description Similar to GAE4: UDP-glucuronate 4-epimerase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45310`	Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components.	No verified direct reference in this release
`At1g02000`	Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components.	No verified direct reference in this release
`At4g00110`	Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components.	No verified direct reference in this release
`At3g23820`	Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components.	Identification and characterization of a UDP-D-glucuronate 4-epimerase in Arabidopsis.2004 · DOI: 10.1016/j.febslet.2004.06.005
`At4g12250`	Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014409 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016020 membrane Cellular Component

GO:0032580 Golgi cisterna membrane Cellular Component

GO:0016854 racemase and epimerase activity Molecular Function

GO:0050378 UDP-glucuronate 4-epimerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G02000

ath:AT2G45310

ath:AT4G00110

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.231

Rank 1 · LXL04_014409 · OH-1004

Endoplasmic reticulum0.206

Rank 2 · LXL04_014409 · OH-1004

Nucleus0.153

Rank 3 · LXL04_014409 · OH-1004

Mitochondrion0.142

Rank 4 · LXL04_014409 · OH-1004

Plastid0.095

Rank 5 · LXL04_014409 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16363.12GDP_Man_Dehyd70-204 aa

PF01370.28Epimerase92-203 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014409	`PF16363.12`	GDP_Man_Dehyd	70	204	3.4e-08	34.1
LXL04_014409	`PF01370.28`	Epimerase	92	203	1.4e-16	61.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22141`	Arabidopsis thaliana	UDP-glucuronate 4-epimerase 4	75.000%	Swiss-Prot	moderate database homology
`Q9LPC1`	Arabidopsis thaliana	UDP-glucuronate 4-epimerase 2	76.087%	Swiss-Prot	moderate database homology
`O81312`	Arabidopsis thaliana	UDP-glucuronate 4-epimerase 3	73.936%	Swiss-Prot	moderate database homology
`Q9LIS3`	Arabidopsis thaliana	UDP-glucuronate 4-epimerase 6	69.399%	Swiss-Prot	moderate database homology
`Q9STI6`	Arabidopsis thaliana	UDP-glucuronate 4-epimerase 5	74.468%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card