TkA04G153590 | RubberDandelionOmics

Gene overview

TkA04G153590

Reference: TK1151 Chr: Chr04 Coordinates: 39713420-39716972 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1416 bp · TkA04G153590|TK1151|cDNA

TACTATCGACTATTCTAAATTCATATATACGACCCAAACCCGTTTTATCTTGGCTCAGGTAGTTGTTTGTTTGCAATTGCTCTCGAAACAAGTCTCATCTCGTTCACGGCTTCAGCACTCTCGACCTCCCCTCCTTTGGCTTCCGTCCATATAATCCCCAACCGCACCTCTTCTCTCTTTGCTCCATCGTCCCTCTGTTCATCACTGTAGGTTTAAACAATCCTTACACCGCGATCATCGTAATCTCAATCCCAATTTTT...

CDS

Download CDS FASTA

786 bp · TkA04G153590|TK1151|CDS

ATGGACTTCGAGGTTGATGATGATGTCAGCAGTGAAGTACTCCTAAACTCCACAGACATAGAAGGCAGAAAAGGCGATGAAATCGAAGATGACATGGTCGGTTGTTCCCTACAAGGCGTATTCCACAACAACAACAACAACAACAACCACGAAATCAAAATCGATCAAGATGAACCCGAAAGAGCCCTAATCCCATTTGACGGGCCCCACAGTGTCAGTAACTCCCTAATGGAAGAACCGTACATCGGTCAAGAATTTGA...

Protein

Download Protein FASTA

261 aa · TkA04G153590|TK1151|PROTEIN

MDFEVDDDVSSEVLLNSTDIEGRKGDEIEDDMVGCSLQGVFHNNNNNNNHEIKIDQDEPERALIPFDGPHSVSNSLMEEPYIGQEFESEASAHAFYNAYATRVGFVIRVSKLSRSRRDGTAIGRALVCNKEGFRMPDKREKIVRQRAETRVGCRAMVLVRKVSSGKWVITKFVKEHTHPLTPGKGRRDLIYDQYPNEHDKIRELSQQLAIEKRRSATYKRHLEMVFEHIEEHNQSLSKKIQDIVNNVSAMESKENGNGSR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G153590`
TK1151 ID	TkA04G153590
OH-1004 ID	LXL04_033442
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	37.900
Protein coverage (%)	TK1151 67.433 / OH-1004 71.915 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G153590

Location Chr04:39713420-39716972 (+)

Description Similar to FRS5: Protein FAR1-RELATED SEQUENCE 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27110`	Putative transcription activator involved in regulating light control of development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033442 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G32250

ath:AT3G06250

ath:AT4G38180

ath:AT5G18960

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.964

Rank 1 · TkA04G153590 · TK1151

Cytoplasm0.096

Rank 2 · TkA04G153590 · TK1151

Cell membrane0.028

Rank 3 · TkA04G153590 · TK1151

Endoplasmic reticulum0.018

Rank 4 · TkA04G153590 · TK1151

Plastid0.013

Rank 5 · TkA04G153590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03101FAR123-51 aa

PF03101FAR195-181 aa

PF26022CC_Liprin_beta191-255 aa

PF26149YuzK202-227 aa

PF03101FAR1225-236 aa

PF26149YuzK230-241 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G153590	`PF03101`	FAR1	23	51	2e-31	109.3
TkA04G153590	`PF03101`	FAR1	95	181	2e-31	109.3
TkA04G153590	`PF26022`	CC_Liprin_beta	191	255	0.065	14.2
TkA04G153590	`PF26149`	YuzK	202	227	0.35	11.7
TkA04G153590	`PF03101`	FAR1	225	236	2e-31	109.3
TkA04G153590	`PF26149`	YuzK	230	241	0.35	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVC9`	Arabidopsis thaliana	sp\|Q9ZVC9\|FRS3_ARATH Protein FAR1-RELATED SEQUENCE 3	36.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card