TkA04G147320 | RubberDandelionOmics

Gene overview

TkA04G147320

Reference: TK1151 Chr: Chr04 Coordinates: 38144782-38145521 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

324 bp · TkA04G147320|TK1151|cDNA

ATGCGAGCACAATCAGGTTCTTCAAATCGAAACACCTTCAGCCCCATTTCTTCAATCCCTTCAATCCCGAACTCAGGACTTTGTAGATTTAGTGAAAATTTGCTTCGTGTATTTGTTAACACCATGGGTCTTGAAGACATCGGCATTGTCACCCTTTCTGGTGGACATACTTTGGGAGCTGCACACAAGGAAAGATCTGGATTTGAAGGACCATGGACCCCAAATCCCCTTATCTTCGACAACTGCTACTTCACGAAATA...

CDS

Download CDS FASTA

324 bp · TkA04G147320|TK1151|CDS

ATGCGAGCACAATCAGGTTCTTCAAATCGAAACACCTTCAGCCCCATTTCTTCAATCCCTTCAATCCCGAACTCAGGACTTTGTAGATTTAGTGAAAATTTGCTTCGTGTATTTGTTAACACCATGGGTCTTGAAGACATCGGCATTGTCACCCTTTCTGGTGGACATACTTTGGGAGCTGCACACAAGGAAAGATCTGGATTTGAAGGACCATGGACCCCAAATCCCCTTATCTTCGACAACTGCTACTTCACGAAATA...

Protein

Download Protein FASTA

107 aa · TkA04G147320|TK1151|PROTEIN

MRAQSGSSNRNTFSPISSIPSIPNSGLCRFSENLLRVFVNTMGLEDIGIVTLSGGHTLGAAHKERSGFEGPWTPNPLIFDNCYFTKYAADEDAFFVDYADLLRRNLV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G147320`
TK1151 ID	TkA04G147320
OH-1004 ID	LXL04_036502
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	43.100
Protein coverage (%)	TK1151 73.832 / OH-1004 42.683 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G147320

Location Chr04:38144782-38145521 (+)

Description Similar to APX1: L-ascorbate peroxidase 1, cytosolic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g09640`	Plays a key role in hydrogen peroxide removal.	Control of Ascorbate Peroxidase 2 expression by hydrogen peroxide and leaf water status during excess light stress reveals a functional organisation of Arabidopsis leaves.2003 · DOI: 10.1046/j.1365-313x.2003.01656.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0694700`	Plays a key role in hydrogen peroxide removal.	Gene knockout study reveals that cytosolic ascorbate peroxidase 2(OsAPX2) plays a critical role in growth and reproduction in rice under drought, salt and cold stresses.2013 · DOI: 10.1371/journal.pone.0057472
`UniProt: A2XFC7`	Plays a key role in hydrogen peroxide removal.	No verified direct reference in this release
`Os03g0285700`	Plays a key role in hydrogen peroxide removal.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036502 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000302 response to reactive oxygen species Biological Process

GO:0009408 response to heat Biological Process

GO:0009699 phenylpropanoid biosynthetic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009809 lignin biosynthetic process Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:0042744 hydrogen peroxide catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G07890

dosa:Os03g0285700

dosa:Os07g0694700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.286

Rank 1 · TkA04G147320 · TK1151

Cytoplasm0.250

Rank 2 · TkA04G147320 · TK1151

Mitochondrion0.133

Rank 3 · TkA04G147320 · TK1151

Nucleus0.130

Rank 4 · TkA04G147320 · TK1151

Plastid0.098

Rank 5 · TkA04G147320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28137GINM1_C26-50 aa

PF00141peroxidase32-67 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G147320	`PF28137`	GINM1_C	26	50	0.31	12.1
TkA04G147320	`PF00141`	peroxidase	32	67	4.7e-06	27.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1PER6`	Arabidopsis thaliana	sp\|Q1PER6\|APX2_ARATH L-ascorbate peroxidase 2, cytosolic	51.000%	Swiss-Prot	Medium
`Q9FE01`	Oryza sativa subsp. japonica	sp\|Q9FE01\|APX2_ORYSJ L-ascorbate peroxidase 2, cytosolic	52.000%	Swiss-Prot	Medium
`A2XFC7`	Oryza sativa subsp. indica	sp\|A2XFC7\|APX1_ORYSI L-ascorbate peroxidase 1, cytosolic	50.000%	Swiss-Prot	Medium
`Q10N21`	Oryza sativa subsp. japonica	sp\|Q10N21\|APX1_ORYSJ L-ascorbate peroxidase 1, cytosolic	50.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card