TkA04G146780 | RubberDandelionOmics

Gene overview

TkA04G146780

Reference: TK1151 Chr: Chr04 Coordinates: 38018781-38020064 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1284 bp · TkA04G146780|TK1151|cDNA

ATGCACACAATCTTCTCTCGTTCAATACGATTTCTAAAATCAATCTCGAAATCCCAAACTCCCCCAAAATCCAGTCATTTCTTTCTTCGCCATTTCTCACAATCAACCTCAATACCCAAAAAACAACAACGACTCCGAGACCATGGATACGACAACTACATGGAAATCGAGAAAAAAATCCGCAAAGTCCTCAAAATCCAAGAACTCATCCTCTCGCAACCCAACTCCATGCTCTCATCTGCTCGCTTAGACAACCTCTC...

CDS

Download CDS FASTA

1284 bp · TkA04G146780|TK1151|CDS

ATGCACACAATCTTCTCTCGTTCAATACGATTTCTAAAATCAATCTCGAAATCCCAAACTCCCCCAAAATCCAGTCATTTCTTTCTTCGCCATTTCTCACAATCAACCTCAATACCCAAAAAACAACAACGACTCCGAGACCATGGATACGACAACTACATGGAAATCGAGAAAAAAATCCGCAAAGTCCTCAAAATCCAAGAACTCATCCTCTCGCAACCCAACTCCATGCTCTCATCTGCTCGCTTAGACAACCTCTC...

Protein

Download Protein FASTA

427 aa · TkA04G146780|TK1151|PROTEIN

MHTIFSRSIRFLKSISKSQTPPKSSHFFLRHFSQSTSIPKKQQRLRDHGYDNYMEIEKKIRKVLKIQELILSQPNSMLSSARLDNLSRRLGFKQFEAGRFVLKFPHIFDIFEHPVQRILYCRLTQKAQIQIQQENKALIAQINDSVTRLRKLLMLSNTGRLGLDHVRIASREFGLPIDFEHSIILKHPEFFRLFEDKETKTKYIEITKRDPNLSICNIEKIREQEYRQKGGDADNIRFAFIINFPPGFKTGKYYKIAIWK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G146780`
TK1151 ID	TkA04G146780
OH-1004 ID	LXL04_035283
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.200
Protein coverage (%)	TK1151 92.974 / OH-1004 63.217 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G146780

Location Chr04:38018781-38020064 (-)

Description Similar to RPD1: Protein ROOT PRIMORDIUM DEFECTIVE 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33495`	Involved in pre-arranging the maintenance of the active cell proliferation during root primordium development.	No verified direct reference in this release
`At4g01037`	RNA-binding protein involved in group II intron splicing.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0571100`	RNA-binding protein involved in group II intron splicing.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035283 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002181 cytoplasmic translation Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009955 adaxial/abaxial pattern specification Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010102 lateral root morphogenesis Biological Process

GO:0048467 gynoecium development Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT2G36620

ath:AT3G53020

ath:AT4G33495

cam:101492846

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.482

Rank 1 · TkA04G146780 · TK1151

Nucleus0.229

Rank 2 · TkA04G146780 · TK1151

Plastid0.199

Rank 3 · TkA04G146780 · TK1151

Cytoplasm0.038

Rank 4 · TkA04G146780 · TK1151

Cell membrane0.009

Rank 5 · TkA04G146780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11955PORR46-381 aa

PF23713WHD_Egal99-112 aa

PF23713WHD_Egal185-196 aa

PF23713WHD_Egal320-339 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G146780	`PF11955`	PORR	46	381	9.4e-106	354.2
TkA04G146780	`PF23713`	WHD_Egal	99	112	0.15	13.3
TkA04G146780	`PF23713`	WHD_Egal	185	196	0.15	13.3
TkA04G146780	`PF23713`	WHD_Egal	320	339	0.15	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q689D6`	Arabidopsis thaliana	sp\|Q689D6\|RPD1_ARATH Protein ROOT PRIMORDIUM DEFECTIVE 1	70.200%	Swiss-Prot	High
`A0MFS5`	Arabidopsis thaliana	sp\|A0MFS5\|WTF1_ARATH Protein WHAT'S THIS FACTOR 1 homolog, chloroplastic	30.400%	Swiss-Prot	Medium
`Q65XL5`	Oryza sativa subsp. japonica	sp\|Q65XL5\|WTF1_ORYSJ Protein WHAT'S THIS FACTOR 1 homolog, chloroplastic	31.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card