LXL04_035283 | RubberDandelionOmics

Gene overview

LXL04_035283

Reference: OH-1004 Chr: Chr08 Coordinates: 19194578-19200347 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1887 bp · LXL04_035283|LXL04_035283|OH1004|cDNA

ATGCACACAATCTTCTCTCGTTCAATACGATTTCTACAATCAATCTCGAAATCTCAAACTCCCCCAAAATCCAGTCATTTCTTTCTTCGCGATTTCTCACAATCAACCTCAATACCCAAAAAACAACAACGAGTCCGAGACCATGGATACGACAACTACATGGAAATCGAGAAAAAAATCCGCAAAGTCCTCAAAATCCAAGAACTCATCCTCTCGCAACCCAACTCCATGCTCTCATCTGCTCGCTTAGACAACCTCTC...

CDS

Download CDS FASTA

1887 bp · LXL04_035283|LXL04_035283|OH1004|CDS

ATGCACACAATCTTCTCTCGTTCAATACGATTTCTACAATCAATCTCGAAATCTCAAACTCCCCCAAAATCCAGTCATTTCTTTCTTCGCGATTTCTCACAATCAACCTCAATACCCAAAAAACAACAACGAGTCCGAGACCATGGATACGACAACTACATGGAAATCGAGAAAAAAATCCGCAAAGTCCTCAAAATCCAAGAACTCATCCTCTCGCAACCCAACTCCATGCTCTCATCTGCTCGCTTAGACAACCTCTC...

Protein

Download Protein FASTA

628 aa · LXL04_035283|LXL04_035283|OH1004|PROTEIN

MHTIFSRSIRFLQSISKSQTPPKSSHFFLRDFSQSTSIPKKQQRVRDHGYDNYMEIEKKIRKVLKIQELILSQPNSMLSSARLDNLSRRLGFKQFEAGRFVLKFPHIFDIFEHPVQRILYCRLTQKAQIQIQQENKALIAQINDSVTRLRKLLMLSNTGRLGLDHVRIASREFGLPIDFEHSIILKHPEFFRLFEDKETKAKYIEITKRDPNLSICNIEKIREQEYRQKGGDADNIRFAFIINFPPGFKTGKYYKIAIWK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035283`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035283

Location Chr08:19194578-19200347 (+)

Description Similar to RPD1: Protein ROOT PRIMORDIUM DEFECTIVE 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33495`	Involved in pre-arranging the maintenance of the active cell proliferation during root primordium development.	No verified direct reference in this release
`At2g36620`	Might have an extraribosomal function in reinitiation of translation.	No verified direct reference in this release
`At3g53020`	Might have an extraribosomal function in reinitiation of translation of ETTIN and MONOPTEROS genes that are involved in the auxin-mediated gynoecium patterning.	The Arabidopsis STV1 protein, responsible for translation reinitiation, is required for auxin-mediated gynoecium patterning.2005 · DOI: 10.1105/tpc.105.036533

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035283 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002181 cytoplasmic translation Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009955 adaxial/abaxial pattern specification Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010102 lateral root morphogenesis Biological Process

GO:0048467 gynoecium development Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT2G36620

ath:AT3G53020

ath:AT4G33495

cam:101492846

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.598

Rank 1 · LXL04_035283 · OH-1004

Plastid0.209

Rank 2 · LXL04_035283 · OH-1004

Nucleus0.142

Rank 3 · LXL04_035283 · OH-1004

Cytoplasm0.049

Rank 4 · LXL04_035283 · OH-1004

Cell membrane0.010

Rank 5 · LXL04_035283 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11955.14PORR45-381 aa

PF01246.27Ribosomal_L24e469-533 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035283	`PF11955.14`	PORR	45	381	3.7e-105	352.2
LXL04_035283	`PF01246.27`	Ribosomal_L24e	469	533	4.6e-28	97.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q689D6`	Arabidopsis thaliana	Protein ROOT PRIMORDIUM DEFECTIVE 1	66.080%	Swiss-Prot	moderate database homology
`Q42347`	Arabidopsis thaliana	Large ribosomal subunit protein eL24z	87.898%	Swiss-Prot	weak database homology
`P38666`	Arabidopsis thaliana	Large ribosomal subunit protein eL24y	88.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card