TkA04G143290 | RubberDandelionOmics

Gene overview

TkA04G143290

Reference: TK1151 Chr: Chr04 Coordinates: 37049172-37051857 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2370 bp · TkA04G143290|TK1151|cDNA

ATGAGTGACAACAAAGGAGGAGACAAGTCCAAGAAACAGAAACATTCGACGCCTTCTCCTAAGGAGAATCTAGTTCAAGAATCCCTAGAAGATCCGTCGGTTGCAGTCGTTGGCCCTACGTTTCTCTCTCCACCACTCCCACTACCACAGCCACCACCGCCGCCACCACCTTCTTCCCAGCTTTACATCACGACGACCGAAACCGTCAATCCCAAAAGACCTAGATACACTAGCGCTACAGGCCAATGGAAGCTCTTACC...

CDS

Download CDS FASTA

2370 bp · TkA04G143290|TK1151|CDS

ATGAGTGACAACAAAGGAGGAGACAAGTCCAAGAAACAGAAACATTCGACGCCTTCTCCTAAGGAGAATCTAGTTCAAGAATCCCTAGAAGATCCGTCGGTTGCAGTCGTTGGCCCTACGTTTCTCTCTCCACCACTCCCACTACCACAGCCACCACCGCCGCCACCACCTTCTTCCCAGCTTTACATCACGACGACCGAAACCGTCAATCCCAAAAGACCTAGATACACTAGCGCTACAGGCCAATGGAAGCTCTTACC...

Protein

Download Protein FASTA

789 aa · TkA04G143290|TK1151|PROTEIN

MSDNKGGDKSKKQKHSTPSPKENLVQESLEDPSVAVVGPTFLSPPLPLPQPPPPPPPSSQLYITTTETVNPKRPRYTSATGQWKLLPSASQKPLPINVVGTDKSPSPSTNHPPPTHAAIAAASSSDTTSSPSHSPRPSVSGQETSKSENEQQYTQHQLRKGKYVSPVWKPNEMLWLARAWRVQYQGGGGTPGSDHASEINLNPITMECNVITPTPTPPSQLQGRGKTRAEKDREVAEFLQRNGVNRDAKTAGTKWDNMLG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G143290`
TK1151 ID	TkA04G143290
OH-1004 ID	LXL04_035316
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.700
Protein coverage (%)	TK1151 100.000 / OH-1004 79.943 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G143290`
Location	Chr04:37049172-37051857 (-)
Description	Similar to CRN8: Crinkler effector protein 8
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035316` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000281 mitotic cytokinesis Biological Process GO:0007163 establishment or maintenance of cell polarity Biological Process GO:0009267 cellular response to starvation Biological Process GO:0031273 negative regulation of pseudopodium assembly Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0043327 chemotaxis to cAMP Biological Process GO:0043408 regulation of MAPK cascade Biological Process GO:0005576 extracellular region Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0042025 host cell nucleus Cellular Component
KEGG gene cross-reference	ddi:DDB_G0267450 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.896

Rank 1 · TkA04G143290 · TK1151

Cytoplasm0.147

Rank 2 · TkA04G143290 · TK1151

Cell membrane0.051

Rank 3 · TkA04G143290 · TK1151

Endoplasmic reticulum0.035

Rank 4 · TkA04G143290 · TK1151

Plastid0.018

Rank 5 · TkA04G143290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28159CEP8985-156 aa

PF13837Myb_DNA-bind_4167-182 aa

PF13837Myb_DNA-bind_4222-274 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G143290	`PF28159`	CEP89	85	156	0.62	9.2
TkA04G143290	`PF13837`	Myb_DNA-bind_4	167	182	0.0011	20.0
TkA04G143290	`PF13837`	Myb_DNA-bind_4	222	274	0.0011	20.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card