TkA04G138210 | RubberDandelionOmics

Gene overview

TkA04G138210

Reference: TK1151 Chr: Chr04 Coordinates: 35870968-35871818 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

423 bp · TkA04G138210|TK1151|cDNA

ATGTTACGATTAAATTATAAATGTAATGCTGGGGATCCTGACAGTCAATCTAAGATCCGGGATCCTGGTATACCATTCAGGATCCTGACCCATAACAACAGTCATCTCGAAGCTCACCCGATCTTCGGAGATCCAACTTCTCTGAAACAGGTTAAATGTCCTTACATATACGACCCTGCAGAAAAATATATCTTACTGATCATTCCTGCAGACAATGAAGAACTCAGACTTCCTGCTGCTCTTGATGAGACAATGAACTA...

CDS

Download CDS FASTA

423 bp · TkA04G138210|TK1151|CDS

ATGTTACGATTAAATTATAAATGTAATGCTGGGGATCCTGACAGTCAATCTAAGATCCGGGATCCTGGTATACCATTCAGGATCCTGACCCATAACAACAGTCATCTCGAAGCTCACCCGATCTTCGGAGATCCAACTTCTCTGAAACAGGTTAAATGTCCTTACATATACGACCCTGCAGAAAAATATATCTTACTGATCATTCCTGCAGACAATGAAGAACTCAGACTTCCTGCTGCTCTTGATGAGACAATGAACTA...

Protein

Download Protein FASTA

140 aa · TkA04G138210|TK1151|PROTEIN

MLRLNYKCNAGDPDSQSKIRDPGIPFRILTHNNSHLEAHPIFGDPTSLKQVKCPYIYDPAEKYILLIIPADNEELRLPAALDETMNYLQQRERKDSSFSYEVIVVDDGSSDRTKRVAFEFVEKYTVDNVRVILFGKNQRK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G138210`
TK1151 ID	TkA04G138210
OH-1004 ID	LXL04_012356
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	86.800
Protein coverage (%)	TK1151 81.429 / OH-1004 30.518 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G138210`
Location	Chr04:35870968-35871818 (+)
Description	Similar to ALG5: Dolichyl-phosphate beta-glucosyltransferase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012356` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006487 protein N-linked glycosylation Biological Process GO:0006488 dolichol-linked oligosaccharide biosynthetic process Biological Process GO:0007009 plasma membrane organization Biological Process GO:0007029 endoplasmic reticulum organization Biological Process GO:0007368 determination of left/right symmetry Biological Process GO:0007379 segment specification Biological Process GO:0009953 dorsal/ventral pattern formation Biological Process GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0016020 membrane Cellular Component GO:0098554 cytoplasmic side of endoplasmic reticulum membrane Cellular Component GO:0098556 cytoplasmic side of rough endoplasmic reticulum membrane Cellular Component GO:0004581 dolichyl-phosphate beta-glucosyltransferase activity Molecular Function
KEGG gene cross-reference	dme:Dmel_CG7870 hsa:29880 mmu:66248 tva:4772265 tva:4774490 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.377

Rank 1 · TkA04G138210 · TK1151

Nucleus0.298

Rank 2 · TkA04G138210 · TK1151

Mitochondrion0.112

Rank 3 · TkA04G138210 · TK1151

Cell membrane0.105

Rank 4 · TkA04G138210 · TK1151

Endoplasmic reticulum0.104

Rank 5 · TkA04G138210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00535Glycos_transf_266-139 aa

PF10111Glyco_tranf_2_278-121 aa

PF00365PFK78-139 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G138210	`PF00535`	Glycos_transf_2	66	139	2e-09	38.3
TkA04G138210	`PF10111`	Glyco_tranf_2_2	78	121	0.13	12.4
TkA04G138210	`PF00365`	PFK	78	139	0.4	10.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card