Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1110 bp · LXL04_012356|LXL04_012356|OH1004|cDNA
TACAATTTGGTCTGTATTTCGACTTTTCGAGTGTATTTTAGGGCTGGTAGAGGTTCCAATTTTGTTGGTTTAGTTTTTGGTTGGTTGTGTCGTCGTCGGATCCTGAAAGGGAACATGGAAATATGGGGATTGTCGACGATGCTTGAACTGACAGTGATTGTAGCAGTAATTTGTGGATTAGGTTTAGCAGTCGCCATTGTTGTTGAAACATTTAGAAGAAGATTGAACCACAATCATCTCGAAGCTCACCCGATCTTCGA...
1104 bp · LXL04_012356|LXL04_012356|OH1004|CDS
TTGGTCTGTATTTCGACTTTTCGAGTGTATTTTAGGGCTGGTAGAGGTTCCAATTTTGTTGGTTTAGTTTTTGGTTGGTTGTGTCGTCGTCGGATCCTGAAAGGGAACATGGAAATATGGGGATTGTCGACGATGCTTGAACTGACAGTGATTGTAGCAGTAATTTGTGGATTAGGTTTAGCAGTCGCCATTGTTGTTGAAACATTTAGAAGAAGATTGAACCACAATCATCTCGAAGCTCACCCGATCTTCGAAGATCC...
Protein
Download Protein FASTA367 aa · LXL04_012356|LXL04_012356|OH1004|PROTEIN
MVCISTFRVYFRAGRGSNFVGLVFGWLCRRRILKGNMEIWGLSTMLELTVIVAVICGLGLAVAIVVETFRRRLNHNHLEAHPIFEDPNSLKQVKCPYIYDPAEKYISLIIPAYNEELRLPAALDETMNYLQQRERKDSSFSYEVIVVDDGSSDGTKRVAFDFVKKYKVDNVRVVLLGKNQGKGEAIRKGMLHSRGKLLLMLDADGATKVDDMEKLEKQILAVAKMKPDEEIEDIPIVAFGSRAHLEKKALATRKWYRNFL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_012356 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_012356 |
|---|---|
| Location | Chr03:10959714-10961812 (-) |
| Description | Similar to ALG5: Dolichyl-phosphate beta-glucosyltransferase |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006487 protein N-linked glycosylation Biological Process GO:0006488 dolichol-linked oligosaccharide biosynthetic process Biological Process GO:0007009 plasma membrane organization Biological Process GO:0007029 endoplasmic reticulum organization Biological Process GO:0007368 determination of left/right symmetry Biological Process GO:0007379 segment specification Biological Process GO:0009953 dorsal/ventral pattern formation Biological Process GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0016020 membrane Cellular Component GO:0098554 cytoplasmic side of endoplasmic reticulum membrane Cellular Component GO:0098556 cytoplasmic side of rough endoplasmic reticulum membrane Cellular Component GO:0004581 dolichyl-phosphate beta-glucosyltransferase activity Molecular Function |
| KEGG gene cross-reference | dme:Dmel_CG7870 hsa:29880 mmu:66248 tva:4772265 tva:4774490 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00535.33Glycos_transf_2107-219 aaPF10111.15Glyco_tranf_2_2120-222 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_012356 | PF00535.33 | Glycos_transf_2 | 107 | 219 | 1.7e-23 | 84.1 |
| LXL04_012356 | PF10111.15 | Glyco_tranf_2_2 | 120 | 222 | 2.3e-06 | 28.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.