TkA04G133280 | RubberDandelionOmics

Gene overview

TkA04G133280

Reference: TK1151 Chr: Chr04 Coordinates: 34657968-34659692 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1403 bp · TkA04G133280|TK1151|cDNA

ATTGCACCATGTAGATATTATGGCATGTCGAATGGTTTTTCTTAAGTTCGTATGCTGCTTAAGATTTTTGCAAGAAACGGGCATGGATGAATAAATGCAATGGTCCCGGTTTCATCCACGCTACTCTAGAAAACAAGAACAGTATGACCCCATGGGACCCAATTACTGATAGTATTCTGCAACCTGCCTACGCATATTATCTGAATCTGGATAATGATTCAGAAAAAGAAATTGTTCTTCATTCATCTTCCCCATTTAAG...

CDS

Download CDS FASTA

909 bp · TkA04G133280|TK1151|CDS

ATGGCTGCTTTTTGTGCATCTCCAACTCCGACCTTACAACTAACAAACACCCATGTACCCCAATCATGTCCCTCTTCTTCATCATCACTCTCGTTTTCGTCAAACAAATCCAGTTTCTTCAACTCATCCTCAACATCTTTCAAGATTTTCGTTCATTCCCTCCCAAAAAACTGCATCACTAAGCAACCACCATCTCTAATTCGAATGTCATGGGATGGTCCTCTCTCCTCCGTGAAATTGATCCTCCAAGGCAAAAATCT...

Protein

Download Protein FASTA

302 aa · TkA04G133280|TK1151|PROTEIN

MAAFCASPTPTLQLTNTHVPQSCPSSSSSLSFSSNKSSFFNSSSTSFKIFVHSLPKNCITKQPPSLIRMSWDGPLSSVKLILQGKNLELSESVKTHVEDKVGKAIQKHSHLVREVDVRVSVRGGEFGKGPKVRRTEVTLFTKKHGVIRAEEEAETTYASIDTVSSVIQRKLRKIKEKDSDHGRHMKGFDRFKVRDPEILIDQDSLAVTQEEVEEEEEEEEDASETEEIVRTKYFDMPPLTVSEAIEQLENVAHDFYGFRN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G133280`
TK1151 ID	TkA04G133280
OH-1004 ID	LXL04_035400
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G133280`
Location	Chr04:34657968-34659692 (+)
Description	Similar to PSRP1: Ribosome-binding factor PSRP1, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035400` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0045900 negative regulation of translational elongation Biological Process GO:0009570 chloroplast stroma Cellular Component GO:0022627 cytosolic small ribosomal subunit Cellular Component GO:0019843 rRNA binding Molecular Function GO:0042803 protein homodimerization activity Molecular Function GO:0043024 ribosomal small subunit binding Molecular Function
KEGG gene cross-reference	bsu:BSU35310 sha:SH2139 syn:sll0947 syp:SYNPCC7002_A0263 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.970

Rank 1 · TkA04G133280 · TK1151

Mitochondrion0.034

Rank 2 · TkA04G133280 · TK1151

Nucleus0.027

Rank 3 · TkA04G133280 · TK1151

Cytoplasm0.017

Rank 4 · TkA04G133280 · TK1151

Cell membrane0.011

Rank 5 · TkA04G133280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02482Ribosomal_S30AE81-177 aa

PF15753BLOC1S382-110 aa

PF15753BLOC1S3161-173 aa

PF15753BLOC1S3176-245 aa

PF29089Protamine-3202-232 aa

PF16321Ribosom_S30AE_C224-279 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G133280	`PF02482`	Ribosomal_S30AE	81	177	6.4e-18	66.0
TkA04G133280	`PF15753`	BLOC1S3	82	110	1.2	9.8
TkA04G133280	`PF15753`	BLOC1S3	161	173	1.2	9.8
TkA04G133280	`PF15753`	BLOC1S3	176	245	1.2	9.8
TkA04G133280	`PF29089`	Protamine-3	202	232	0.32	11.9
TkA04G133280	`PF16321`	Ribosom_S30AE_C	224	279	5.9e-24	84.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card