TkA04G132270 | RubberDandelionOmics

Gene overview

TkA04G132270

Reference: TK1151 Chr: Chr04 Coordinates: 34424957-34426636 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1158 bp · TkA04G132270|TK1151|cDNA

TATGGAAAATTAAAGTGGTACAAGACCCAGCCGTCTACTGTTGTTTTGCTATTTTTCAATCACAACCCAATCAAGAACAAAAACCCACCGTCTCCTTCCCTTAAGCCCCCCACCATCTCCGTATTGCCTTCACTCCCTCACAAACACCCTAAACTTTCCAGCTCTCGTCTTCTTCATAGCAACGATGGCGGGAGGAAAGCAAGGCGAGTTAGTGGTTCAAACGCCAAACGATTTGGCCCACAATCCAATCACACAATTGC...

CDS

Download CDS FASTA

786 bp · TkA04G132270|TK1151|CDS

ATGGCGGGAGGAAAGCAAGGCGAGTTAGTGGTTCAAACGCCAAACGATTTGGCCCACAATCCAATCACACAATTGCAAACCAAGTACAAAGAATTAGAGAACGGCTTCAAGGCATGGCTTGCGAAACAGTCTTTACCGGTTGAGGCCGCCGTCGTTACCCTCACAAGCGCAACCCAGGGCGCAGCCATGGGTGGTTTCATGGGCACACTCACCAACGATGTCTCCTCCGCTTTCCCCGCCGCACCACCTCCCGGCTCCTC...

Protein

Download Protein FASTA

261 aa · TkA04G132270|TK1151|PROTEIN

MAGGKQGELVVQTPNDLAHNPITQLQTKYKELENGFKAWLAKQSLPVEAAVVTLTSATQGAAMGGFMGTLTNDVSSAFPAAPPPGSSVNPQAMASFQQAQALAGGPLIQARNFAVMTGVNAGISCVLRRLRGKEDVQSSMAAAFGSGVMFTLVSGMGGPNQATNVITSGLFFALVQGGLFKVGEKFSKPAVEDVMYSETRAMLSNLGLGNYEKNFKKGLLTDSTLPLLTDSALKDVSIPPGPRLVILDHVQRNKEVKKRG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G132270`
TK1151 ID	TkA04G132270
OH-1004 ID	LXL04_035417
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G132270

Location Chr04:34424957-34426636 (-)

Description Similar to HP30-2: Chloroplastic import inner membrane translocase subunit HP30-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24650`	Together with HP30-1 and HP20, triggers the import and insertion of transit sequence-less multi-pass transmembrane proteins (e.g. CEQORH) into the chloroplastic inner membrane.	Three proteins mediate import of transit sequence-less precursors into the inner envelope of chloroplasts in Arabidopsis thaliana.2013 · DOI: 10.1073/pnas.1319648110
`At3g49560`	Together with HP30-2 and HP20, triggers the import and insertion of transit sequence-less multi-pass transmembrane proteins (e.g. CEQORH) into the chloroplastic inner membrane.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035417 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007005 mitochondrion organization Biological Process

GO:0016031 tRNA import into mitochondrion Biological Process

GO:0045036 protein targeting to chloroplast Biological Process

GO:0045039 protein insertion into mitochondrial inner membrane Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005744 TIM23 mitochondrial import inner membrane translocase complex Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT3G49560

ath:AT5G24650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.872

Rank 1 · TkA04G132270 · TK1151

Plastid0.083

Rank 2 · TkA04G132270 · TK1151

Cytoplasm0.070

Rank 3 · TkA04G132270 · TK1151

Nucleus0.054

Rank 4 · TkA04G132270 · TK1151

Cell membrane0.031

Rank 5 · TkA04G132270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07647SAM_213-26 aa

PF02466Tim1749-175 aa

PF00536SAM_1203-252 aa

PF07647SAM_2203-254 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G132270	`PF07647`	SAM_2	13	26	0.0054	17.6
TkA04G132270	`PF02466`	Tim17	49	175	5.6e-12	46.7
TkA04G132270	`PF00536`	SAM_1	203	252	1.2e-05	26.3
TkA04G132270	`PF07647`	SAM_2	203	254	0.0054	17.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLT9`	Arabidopsis thaliana	sp\|Q9FLT9\|HP302_ARATH Chloroplastic import inner membrane translocase subunit HP30-2	62.000%	Swiss-Prot	High
`Q9SCK3`	Arabidopsis thaliana	sp\|Q9SCK3\|HP301_ARATH Chloroplastic import inner membrane translocase subunit HP30-1	59.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card