LXL04_035417 | RubberDandelionOmics

Gene overview

LXL04_035417

Reference: OH-1004 Chr: Chr08 Coordinates: 22196825-22198126 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

786 bp · LXL04_035417|LXL04_035417|OH1004|cDNA

ATGGCGGGAGGAAAGCAAGGCGAGTTAGTGGTTCAAACGCCAAACGATTTGGCCCACAATCCAATCACACAATTGCAAACCAAGTACAAAGAATTAGAGAACGGCTTCAAGGCATGGCTTGCCAAACAGTCTTTACCGGTTGAGGCCGCCGTCGTTACCCTAACAAGCGCAACCCAAGGCGCAGCCATGGGTGGTTTCATGGGTACACTCACCAACGATGTCTCCTCCGCTTTCCCCGCCGCACCACCTCCCGGCGGCTC...

CDS

Download CDS FASTA

786 bp · LXL04_035417|LXL04_035417|OH1004|CDS

ATGGCGGGAGGAAAGCAAGGCGAGTTAGTGGTTCAAACGCCAAACGATTTGGCCCACAATCCAATCACACAATTGCAAACCAAGTACAAAGAATTAGAGAACGGCTTCAAGGCATGGCTTGCCAAACAGTCTTTACCGGTTGAGGCCGCCGTCGTTACCCTAACAAGCGCAACCCAAGGCGCAGCCATGGGTGGTTTCATGGGTACACTCACCAACGATGTCTCCTCCGCTTTCCCCGCCGCACCACCTCCCGGCGGCTC...

Protein

Download Protein FASTA

261 aa · LXL04_035417|LXL04_035417|OH1004|PROTEIN

MAGGKQGELVVQTPNDLAHNPITQLQTKYKELENGFKAWLAKQSLPVEAAVVTLTSATQGAAMGGFMGTLTNDVSSAFPAAPPPGGSLNSQTMASFQQAQALAGGPLIQARNFAVMTGVNAGISCVMKRLRGKEDVQSSMVAAFGSGVMFSLVSGMGGPNQATNVITSGVFFALVQGGLFKVGEKFSKPSVEDVMYSETRAMLSNLGLGNYEKNFKKGLLTDSTLPLLTDSALKDVSIPPGPRLVILDHVQRNKEVKKRG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035417`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035417

Location Chr08:22196825-22198126 (+)

Description Similar to HP30-2: Chloroplastic import inner membrane translocase subunit HP30-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24650`	Together with HP30-1 and HP20, triggers the import and insertion of transit sequence-less multi-pass transmembrane proteins (e.g. CEQORH) into the chloroplastic inner membrane.	Three proteins mediate import of transit sequence-less precursors into the inner envelope of chloroplasts in Arabidopsis thaliana.2013 · DOI: 10.1073/pnas.1319648110
`At3g49560`	Together with HP30-2 and HP20, triggers the import and insertion of transit sequence-less multi-pass transmembrane proteins (e.g. CEQORH) into the chloroplastic inner membrane.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035417 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007005 mitochondrion organization Biological Process

GO:0016031 tRNA import into mitochondrion Biological Process

GO:0045036 protein targeting to chloroplast Biological Process

GO:0045039 protein insertion into mitochondrial inner membrane Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005744 TIM23 mitochondrial import inner membrane translocase complex Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT3G49560

ath:AT5G24650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.848

Rank 1 · LXL04_035417 · OH-1004

Plastid0.102

Rank 2 · LXL04_035417 · OH-1004

Cytoplasm0.072

Rank 3 · LXL04_035417 · OH-1004

Nucleus0.053

Rank 4 · LXL04_035417 · OH-1004

Cell membrane0.030

Rank 5 · LXL04_035417 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02466.25Tim1749-175 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035417	`PF02466.25`	Tim17	49	175	3.5e-13	50.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLT9`	Arabidopsis thaliana	Chloroplastic import inner membrane translocase subunit HP30-2	62.963%	Swiss-Prot	strong database homology
`Q9SCK3`	Arabidopsis thaliana	Chloroplastic import inner membrane translocase subunit HP30-1	59.671%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card