TkA04G129690 | RubberDandelionOmics

Gene overview

TkA04G129690

Reference: TK1151 Chr: Chr04 Coordinates: 33750517-33753478 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1857 bp · TkA04G129690|TK1151|cDNA

CTTGTAATTGCTTCAAAGATTTAATCCAGTAATATACCGGAGATTATACGTGCGACAGCGGCGGTGCTCGTGAGCGAAGACAGATAAAACTCAAAAACCTTTTTTTTTTTAATTGGAGGTGCCGGCGATGTCTTTGTGAAATCAATCCTTTAATCCTTTTCAAGAAACCAAATACACACATTTGATTTTCGCAAGATTGTTCCTTTTCGTCTTTTGTTTCCCCTTTGAATCTGTTCTCGATCCTTTTTATCTGATATTAG...

CDS

Download CDS FASTA

1206 bp · TkA04G129690|TK1151|CDS

ATGGATGAGGTGAACATCAACACTACTTGTACCACCGTGACAGCAGATGATAGCTTAACATCCGCATCAGCATCAGTACCATGGAGTCCTAGACAGCTCGTCTTCCGACCTTATACGCCGACTTCTAACACTGATGCAAAGTCACAGAATCTGCGTGTTCACGTTAAAAGACCTTTGGTATCAAGATTAACGAAGGACATAGTCGACACATACCGTACATGCAACCCGCAGTTTTATTATCCAGAAGAATTATTAGTCCC...

Protein

Download Protein FASTA

401 aa · TkA04G129690|TK1151|PROTEIN

MDEVNINTTCTTVTADDSLTSASASVPWSPRQLVFRPYTPTSNTDAKSQNLRVHVKRPLVSRLTKDIVDTYRTCNPQFYYPEELLVPKRFLTSPSAGVLNDGYDNENSDLVLSVNFALVNPDTHRRYIVKEMLGQGTFGQVAKCWVAELERFVAVKIIKNQPAYYQQALVEVTLLTTLNKKFDPEDKHHIVRIYDYFVYQRHLCIGFELLDSNLYEIIKLNHFRGLSLSIVQLFSKQILCGLSLMKDAAIIHCDLKPENI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G129690`
TK1151 ID	TkA04G129690
OH-1004 ID	LXL04_035454
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 99.252 / OH-1004 43.688 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G129690

Location Chr04:33750517-33753478 (+)

Description Similar to YAK1: Dual specificity protein kinase YAK1 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g35980`	Dual specificity protein kinase that phosphorylates ANN1, ANN2 and CP29B at serine and threonine residues, and ANN1, ANN2 and ANN4 at tyrosine residues.	Arabidopsis Yak1 protein (AtYak1) is a dual specificity protein kinase.2015 · DOI: 10.1016/j.febslet.2015.09.025 Arabidopsis YAK1 regulates abscisic acid response and drought resistance.2016 · DOI: 10.1002/1873-3468.12234

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035454 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006935 chemotaxis Biological Process

GO:0006972 hyperosmotic response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0008277 regulation of G protein-coupled receptor signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010225 response to UV-C Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0010629 negative regulation of gene expression Biological Process

KEGG gene cross-reference

ath:AT5G35980

ddi:DDB_G0283605

dme:Dmel_CG42273

sce:YJL141C

spo:2542228

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.569

Rank 1 · TkA04G129690 · TK1151

Nucleus0.500

Rank 2 · TkA04G129690 · TK1151

Mitochondrion0.068

Rank 3 · TkA04G129690 · TK1151

Cell membrane0.050

Rank 4 · TkA04G129690 · TK1151

Endoplasmic reticulum0.036

Rank 5 · TkA04G129690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase127-342 aa

PF07714PK_Tyr_Ser-Thr129-343 aa

PF03109ABC1131-161 aa

PF01163RIO1207-284 aa

PF03109ABC1234-285 aa

PF01636APH247-283 aa

PF19974TCAD9248-279 aa

PF10501Ribosomal_L50326-367 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G129690	`PF00069`	Pkinase	127	342	2.2e-43	149.3
TkA04G129690	`PF07714`	PK_Tyr_Ser-Thr	129	343	8.1e-22	78.5
TkA04G129690	`PF03109`	ABC1	131	161	0.045	13.6
TkA04G129690	`PF01163`	RIO1	207	284	0.086	13.2
TkA04G129690	`PF03109`	ABC1	234	285	0.045	13.6
TkA04G129690	`PF01636`	APH	247	283	0.044	14.2
TkA04G129690	`PF19974`	TCAD9	248	279	0.21	11.4
TkA04G129690	`PF10501`	Ribosomal_L50	326	367	0.0029	18.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWH3`	Arabidopsis thaliana	sp\|Q8RWH3\|YAK1_ARATH Dual specificity protein kinase YAK1 homolog	70.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card