LXL04_035454 | RubberDandelionOmics

Gene overview

LXL04_035454

Reference: OH-1004 Chr: Chr08 Coordinates: 22861024-22865942 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2736 bp · LXL04_035454|LXL04_035454|OH1004|cDNA

ATGGATGAGGTCAACATCAACACTACTTGTACCACCGTGACAGCAGATGATAGCTTATCATCCGCATCAGCATCAGTACCATGGAGTCCTAGACAGCTCGTCTTCCGACCTTATACGCCGACTTCTAACACTGATGCAAAGTCACAGAATCTGCGTGTTCACGTTAAAAGACCTTTGGTATCAAGATTAACGAAGGACATAGTCGACACATACCGTACATGCAACCCACAGTTTTATTATCCAGAAGAATTATTAGTCCC...

CDS

Download CDS FASTA

2736 bp · LXL04_035454|LXL04_035454|OH1004|CDS

ATGGATGAGGTCAACATCAACACTACTTGTACCACCGTGACAGCAGATGATAGCTTATCATCCGCATCAGCATCAGTACCATGGAGTCCTAGACAGCTCGTCTTCCGACCTTATACGCCGACTTCTAACACTGATGCAAAGTCACAGAATCTGCGTGTTCACGTTAAAAGACCTTTGGTATCAAGATTAACGAAGGACATAGTCGACACATACCGTACATGCAACCCACAGTTTTATTATCCAGAAGAATTATTAGTCCC...

Protein

Download Protein FASTA

911 aa · LXL04_035454|LXL04_035454|OH1004|PROTEIN

MDEVNINTTCTTVTADDSLSSASASVPWSPRQLVFRPYTPTSNTDAKSQNLRVHVKRPLVSRLTKDIVDTYRTCNPQFYYPEELLVPKRFLTSPSAGVLNDGYDNENSDLVLSVNFALVNPDTHRRYIVKEMLGQGTFGQVAKCWVAELERFVAVKIIKNQPAYYQQALVEVTLLTTLNKKFDPEDKHHIVRIYDYFVYQRHLCIGFELLDSNLYEIIKLNHFRGLSLSIVQLFSKQILCGLSLMKDAAIIHCDLKPENI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035454`
TK1151 ID	TkA04G129690
OH-1004 ID	LXL04_035454
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 99.252 / OH-1004 43.688 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035454

Location Chr08:22861024-22865942 (-)

Description Similar to YAK1: Dual specificity protein kinase YAK1 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g35980`	Dual specificity protein kinase that phosphorylates ANN1, ANN2 and CP29B at serine and threonine residues, and ANN1, ANN2 and ANN4 at tyrosine residues.	Arabidopsis Yak1 protein (AtYak1) is a dual specificity protein kinase.2015 · DOI: 10.1016/j.febslet.2015.09.025 Arabidopsis YAK1 regulates abscisic acid response and drought resistance.2016 · DOI: 10.1002/1873-3468.12234

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035454 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006935 chemotaxis Biological Process

GO:0006972 hyperosmotic response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0008277 regulation of G protein-coupled receptor signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010225 response to UV-C Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0010629 negative regulation of gene expression Biological Process

KEGG gene cross-reference

ath:AT5G35980

ddi:DDB_G0283605

dme:Dmel_CG42273

sce:YJL141C

spo:2542228

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.637

Rank 1 · LXL04_035454 · OH-1004

Nucleus0.448

Rank 2 · LXL04_035454 · OH-1004

Cell membrane0.047

Rank 3 · LXL04_035454 · OH-1004

Mitochondrion0.036

Rank 4 · LXL04_035454 · OH-1004

Endoplasmic reticulum0.033

Rank 5 · LXL04_035454 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase127-340 aa

PF07714.24PK_Tyr_Ser-Thr129-343 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035454	`PF00069.32`	Pkinase	127	340	9.1e-49	166.9
LXL04_035454	`PF07714.24`	PK_Tyr_Ser-Thr	129	343	4.2e-21	76.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWH3`	Arabidopsis thaliana	Dual specificity protein kinase YAK1 homolog	56.917%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card