TkA04G126060 | RubberDandelionOmics

Gene overview

TkA04G126060

Reference: TK1151 Chr: Chr04 Coordinates: 32753150-32754538 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

779 bp · TkA04G126060|TK1151|cDNA

TTTTTTTTTGTGGAGTTTTGTAAAAAATGAATTCGCGGAAGATGGCGGTACGGGAAGGCGCAACGGCATGATGGACGGCGACGACGAAGACGAAGGAATCCTCGTATTAGAAGAAGGAGCTATGCCGGAATCTGATTTCGAAGACACCCCTCCCCACCTTCGCGACCTTGCCGCCGCCGCCATGCACGGCGACGCTGTTGCTCTTCGTCAAGCCCTCGATAATTTGAATGGAAGCATCGATGAACCAGTTGAAGATGGGG...

CDS

Download CDS FASTA

603 bp · TkA04G126060|TK1151|CDS

ATGATGGACGGCGACGACGAAGACGAAGGAATCCTCGTATTAGAAGAAGGAGCTATGCCGGAATCTGATTTCGAAGACACCCCTCCCCACCTTCGCGACCTTGCCGCCGCCGCCATGCACGGCGACGCTGTTGCTCTTCGTCAAGCCCTCGATAATTTGAATGGAAGCATCGATGAACCAGTTGAAGATGGGGATACTGCTCTTCATCTCACCTGTCTCTATGGCCATCTGTCTTGTGTCCAGGTATTGTTGGAAAGGGG...

Protein

Download Protein FASTA

200 aa · TkA04G126060|TK1151|PROTEIN

MMDGDDEDEGILVLEEGAMPESDFEDTPPHLRDLAAAAMHGDAVALRQALDNLNGSIDEPVEDGDTALHLTCLYGHLSCVQVLLERGASVEAKDEDGGIPLHDACAGGFLEIVQLLIGKADSQECLKRMLDSVDVEGDTPLHHAARGEHEQIVGLLLSLGASPTKTNVYGKTPGELAEANTVAWTILESATRGNGIASHV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G126060`
TK1151 ID	TkA04G126060
OH-1004 ID	LXL04_035510
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 93.458 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G126060`
Location	Chr04:32753150-32754538 (+)
Description	Similar to ANKRD1: Ankyrin repeat domain-containing protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035510` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0001894 tissue homeostasis Biological Process GO:0006281 DNA repair Biological Process GO:0006282 regulation of DNA repair Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006974 DNA damage response Biological Process GO:0007283 spermatogenesis Biological Process GO:0016567 protein ubiquitination Biological Process GO:0031441 negative regulation of mRNA 3'-end processing Biological Process GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process GO:0034599 cellular response to oxidative stress Biological Process
KEGG gene cross-reference	dme:Dmel_CG4719 hsa:580 ocu:100008719 rno:27064 rno:64557 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.615

Rank 1 · TkA04G126060 · TK1151

Nucleus0.606

Rank 2 · TkA04G126060 · TK1151

Mitochondrion0.057

Rank 3 · TkA04G126060 · TK1151

Cell membrane0.051

Rank 4 · TkA04G126060 · TK1151

Endoplasmic reticulum0.045

Rank 5 · TkA04G126060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24521Ank_KRIT132-88 aa

PF12796Ank_235-119 aa

PF00023Ank36-42 aa

PF13637Ank_436-84 aa

PF13606Ank_336-57 aa

PF13857Ank_562-101 aa

PF00023Ank63-94 aa

PF13606Ank_363-91 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G126060	`PF24521`	Ank_KRIT1	32	88	8.4e-09	36.0
TkA04G126060	`PF12796`	Ank_2	35	119	8.2e-23	81.5
TkA04G126060	`PF00023`	Ank	36	42	1.3e-22	79.3
TkA04G126060	`PF13637`	Ank_4	36	84	2.8e-18	66.3
TkA04G126060	`PF13606`	Ank_3	36	57	1.8e-13	49.9
TkA04G126060	`PF13857`	Ank_5	62	101	3.2e-14	53.6
TkA04G126060	`PF00023`	Ank	63	94	1.3e-22	79.3
TkA04G126060	`PF13606`	Ank_3	63	91	1.8e-13	49.9
TkA04G126060	`PF13637`	Ank_4	74	117	2.8e-18	66.3
TkA04G126060	`PF00023`	Ank	97	121	1.3e-22	79.3
TkA04G126060	`PF13857`	Ank_5	100	119	3.2e-14	53.6
TkA04G126060	`PF13606`	Ank_3	100	118	1.8e-13	49.9
TkA04G126060	`PF24521`	Ank_KRIT1	101	180	8.4e-09	36.0
TkA04G126060	`PF12796`	Ank_2	121	166	8.2e-23	81.5
TkA04G126060	`PF13637`	Ank_4	123	157	2.8e-18	66.3
TkA04G126060	`PF13857`	Ank_5	136	177	3.2e-14	53.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card