LXL04_035510 | RubberDandelionOmics

Gene overview

LXL04_035510

Reference: OH-1004 Chr: Chr08 Coordinates: 23805013-23806267 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

645 bp · LXL04_035510|LXL04_035510|OH1004|cDNA

ATGAATTCGCGGAAGATGGCGGTACCGGGAAGGCGCAACGGCATGATGGACGGCGACGACGAAGACGAAGGAATCCTCGTATTAGAAGAAGGAGCTATGCCGGAATCTGATTTCGAAGACACCCCTCCCCACCTTCGCGACCTTGCCGCCGCCGCCATGCACGGCGACGCTGTTGCTCTTCGTCAAGCCCTCGATAATTTGAATGGAAGCATCGATGAACCAGTTGAAGATGGGGATACTGCTCTTCATCTCACCTGTCT...

CDS

Download CDS FASTA

645 bp · LXL04_035510|LXL04_035510|OH1004|CDS

ATGAATTCGCGGAAGATGGCGGTACCGGGAAGGCGCAACGGCATGATGGACGGCGACGACGAAGACGAAGGAATCCTCGTATTAGAAGAAGGAGCTATGCCGGAATCTGATTTCGAAGACACCCCTCCCCACCTTCGCGACCTTGCCGCCGCCGCCATGCACGGCGACGCTGTTGCTCTTCGTCAAGCCCTCGATAATTTGAATGGAAGCATCGATGAACCAGTTGAAGATGGGGATACTGCTCTTCATCTCACCTGTCT...

Protein

Download Protein FASTA

214 aa · LXL04_035510|LXL04_035510|OH1004|PROTEIN

MNSRKMAVPGRRNGMMDGDDEDEGILVLEEGAMPESDFEDTPPHLRDLAAAAMHGDAVALRQALDNLNGSIDEPVEDGDTALHLTCLYGHLSCVQVLLERGASVEAKDEDGGIPLHDACAGGFLEIVQLLIGKADSQECLKRMLDSVDVEGDTPLHHAARGEHEQIVGLLLSLGASPTKTNVYGKTPGELAEANTVAWTILESATRGNGIASHV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035510`
TK1151 ID	TkA04G126060
OH-1004 ID	LXL04_035510
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 93.458 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_035510`
Location	Chr08:23805013-23806267 (-)
Description	Similar to ANKRD1: Ankyrin repeat domain-containing protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035510` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0001894 tissue homeostasis Biological Process GO:0006281 DNA repair Biological Process GO:0006282 regulation of DNA repair Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006974 DNA damage response Biological Process GO:0007283 spermatogenesis Biological Process GO:0016567 protein ubiquitination Biological Process GO:0031441 negative regulation of mRNA 3'-end processing Biological Process GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process GO:0034599 cellular response to oxidative stress Biological Process
KEGG gene cross-reference	dme:Dmel_CG4719 hsa:580 ocu:100008719 rno:27064 rno:64557 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.614

Rank 1 · LXL04_035510 · OH-1004

Cytoplasm0.575

Rank 2 · LXL04_035510 · OH-1004

Mitochondrion0.055

Rank 3 · LXL04_035510 · OH-1004

Cell membrane0.055

Rank 4 · LXL04_035510 · OH-1004

Endoplasmic reticulum0.047

Rank 5 · LXL04_035510 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12796.14Ank_249-133 aa

PF13857.13Ank_576-115 aa

PF00023.37Ank77-108 aa

PF13637.13Ank_488-131 aa

PF24521.3Ank_KRIT1115-194 aa

PF12796.14Ank_2135-180 aa

PF13637.13Ank_4137-171 aa

PF00023.37Ank151-181 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035510	`PF12796.14`	Ank_2	49	133	1.1e-22	81.1
LXL04_035510	`PF13857.13`	Ank_5	76	115	4.2e-14	53.2
LXL04_035510	`PF00023.37`	Ank	77	108	2.2e-22	78.6
LXL04_035510	`PF13637.13`	Ank_4	88	131	4.1e-18	65.8
LXL04_035510	`PF24521.3`	Ank_KRIT1	115	194	1.1e-08	35.7
LXL04_035510	`PF12796.14`	Ank_2	135	180	1.1e-22	81.1
LXL04_035510	`PF13637.13`	Ank_4	137	171	4.1e-18	65.8
LXL04_035510	`PF00023.37`	Ank	151	181	2.2e-22	78.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card