TkA04G124470 | RubberDandelionOmics

Gene overview

TkA04G124470

Reference: TK1151 Chr: Chr04 Coordinates: 32341191-32345734 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2773 bp · TkA04G124470|TK1151|cDNA

AAAAGGGAAAGTGAATTTCAATTCCAATTCCAAGGCTGAATGGAAAAGCTACAAATTGCAATTCCGGAAGTAGCTTTAGCTGCTTTTTCGGCCATGTCTTCCCCTCGCCCCTCTTCTTTCCCTTTCTTTTGACAAGCTTCAGTGACATTATTGTTCTTTCCTTCACTCACTCACACATTCTCTCTTTCTACCTGGACATGAACGGTTATAGTTGAGGGACGCAGGCGTTTTCCTCCATGGCAGCAGTTGCTGATTCATCA...

CDS

Download CDS FASTA

2391 bp · TkA04G124470|TK1151|CDS

ATGGCAGCAGTTGCTGATTCATCACACATTTTACTTGTTTGCTGCTACCTCTGTCCAAACAAGAAAACATACAAGAGATTGAGTAAATACTGCTCTCTCGAGCTCGATGGTTCTTCTTATCCTACTAGGGTTTCGTTTGATTCGTTGTCAACAAGGCGGCAAAGAGGATTTTCGTTGTCTGTAACCGGTCGAGAAATTGCTGACGTTCGAGTCACTGATAATAGCAACAATGTTCATCATACACGATCTGCATTTGTTGA...

Protein

Download Protein FASTA

796 aa · TkA04G124470|TK1151|PROTEIN

MAAVADSSHILLVCCYLCPNKKTYKRLSKYCSLELDGSSYPTRVSFDSLSTRRQRGFSLSVTGREIADVRVTDNSNNVHHTRSAFVEIPVTCYQVRCPRFILGIPAKSEKDEIVKSMKHLKLAEMEEGYTMDTVVSRQNLLMDVRDKLLFEADYAGNVREKVPPKSSLQIPWSWLPGALSLLQEVGEEKLALDIGRTALQHPDSKPFVHDLLLSMALAECAIAKSNFEKNKISQGFEALARAQSLLKSKPSLEQMTLLSQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G124470`
TK1151 ID	TkA04G124470
OH-1004 ID	LXL04_035541
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G124470

Location Chr04:32341191-32345734 (+)

Description Similar to CDP1: Plastid division protein CDP1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g19180`	Component of the plastid division machinery required for PDV1 localization to constriction sites.	PARC6, a novel chloroplast division factor, influences FtsZ assembly and is required for recruitment of PDV1 during chloroplast division in Arabidopsis.2009 · DOI: 10.1111/j.1365-313x.2009.03905.x CDP1, a novel component of chloroplast division site positioning system in Arabidopsis.2009 · DOI: 10.1038/cr.2009.78 The chloroplast min system functions differentially in two specific nongreen plastids in Arabidopsis thaliana.2013 · DOI: 10.1371/journal.pone.0071190 Roles of Arabidopsis PARC6 in Coordination of the Chloroplast Division Complex and Negative Regulation of FtsZ Assembly.2016 · DOI: 10.1104/pp.15.01460 Isolation and analysis of a stromule-overproducing Arabidopsis mutant suggest the role of PARC6 in plastid morphology maintenance in the leaf epidermis.2018 · DOI: 10.1111/ppl.12648 ARC3 Activation by PARC6 Promotes FtsZ-Ring Remodeling at the Chloroplast Division Site.2019 · DOI: 10.1105/tpc.18.00948

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035541 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0010020 chloroplast fission Biological Process

GO:0043572 plastid fission Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009528 plastid inner membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT3G19180

ath:AT5G42480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.961

Rank 1 · TkA04G124470 · TK1151

Nucleus0.042

Rank 2 · TkA04G124470 · TK1151

Mitochondrion0.036

Rank 3 · TkA04G124470 · TK1151

Cytoplasm0.028

Rank 4 · TkA04G124470 · TK1151

Cell membrane0.018

Rank 5 · TkA04G124470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25515Arm_PDR169-315 aa

PF13355ARC6-like_IMS312-362 aa

PF25515Arm_PDR319-350 aa

PF23468ARC6354-483 aa

PF13355ARC6-like_IMS629-647 aa

PF23468ARC6667-688 aa

PF25240PUB2_N667-679 aa

PF13355ARC6-like_IMS670-787 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G124470	`PF25515`	Arm_PDR	169	315	1.2e-47	162.4
TkA04G124470	`PF13355`	ARC6-like_IMS	312	362	9.6e-29	101.0
TkA04G124470	`PF25515`	Arm_PDR	319	350	1.2e-47	162.4
TkA04G124470	`PF23468`	ARC6	354	483	3e-10	40.5
TkA04G124470	`PF13355`	ARC6-like_IMS	629	647	9.6e-29	101.0
TkA04G124470	`PF23468`	ARC6	667	688	3e-10	40.5
TkA04G124470	`PF25240`	PUB2_N	667	679	0.056	14.2
TkA04G124470	`PF13355`	ARC6-like_IMS	670	787	9.6e-29	101.0
TkA04G124470	`PF25240`	PUB2_N	728	789	0.056	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VY16`	Arabidopsis thaliana	sp\|Q8VY16\|CDP1_ARATH Plastid division protein CDP1, chloroplastic	51.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card