Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3467 bp · TkA04G123890|TK1151|cDNA
GGGAAAAACCACGGGCAGCGGAAGCCGAGAACCAATTCACTATATTTTTAGAATGTTACAGAGATTGGATAGAGATTACAAAAGAGAGAGAGCTATATGGTGAAAGGTTTTGTTTTTGGTTATAACAAACCAATTAATTCAGACGATCTTATAAACTGATCGCGATCTATATATATATATAGATCGTCTTGCAAAAAAATTCAAAAGGTGCAGGTCCCACAGATTGACAAAAGCCTTCTCAATTGTCAAAAAGGAACAAA...
2301 bp · TkA04G123890|TK1151|CDS
ATGGCGTCCTTTGCATTGTTTGTGGGGTTCGTTGTTGGGGCATTAGCTGTAATCGGTGTTGAAGTTTTGGGAGTATTGTTCTTCATACGAAAATTAAGTAGAAAGGTGAAGGAAGATGATCTTAAGGTCGCGAAATCTGTGTCGTCTGAAAGAGAGGAACTCCAATTTTCATTCCCCAACAAACAGGGTTGGGTTTGGATTTTAGAAAAGGAAAAGATCCCAAAGACTTCACCATCTAGTGATAAAGGACCACGTCTACA...
Protein
Download Protein FASTA766 aa · TkA04G123890|TK1151|PROTEIN
MASFALFVGFVVGALAVIGVEVLGVLFFIRKLSRKVKEDDLKVAKSVSSEREELQFSFPNKQGWVWILEKEKIPKTSPSSDKGPRLQKRKIEVLEVSPVRKHASIKDLSLIITEPDGTLTKIPLSGCTAEAVSATNLPSRKWAKKYPVKLENKSSVLYHGSKLFYLYFETSCEKESWCKALRLASCDDKEKLKWFHKSRADFHNYLGSLNVEYPSFLKPSIGFNQETGDKTIKIDTSSSKVRHFLKKLAKKTSKAGKEDK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G123890 |
|---|---|
| TK1151 ID | TkA04G123890 |
| OH-1004 ID | LXL04_035554 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 99.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G123890 |
|---|---|
| Location | Chr04:32181205-32189815 (+) |
| Description | Similar to Tex2: Testis-expressed protein 2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006665 sphingolipid metabolic process Biological Process GO:0006869 lipid transport Biological Process GO:0007165 signal transduction Biological Process GO:0035621 ER to Golgi ceramide transport Biological Process GO:1990854 vacuole-ER tethering Biological Process GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0016020 membrane Cellular Component GO:0031965 nuclear membrane Cellular Component GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane Cellular Component GO:0071561 nucleus-vacuole junction Cellular Component |
| KEGG gene cross-reference | hsa:55852 mmu:21763 sce:YPR091C spo:2540553 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF23065PH_SMPa60-186 aaPF17095CAMSAP_CC187-93 aaPF00169PH97-184 aaPF16746BAR_3230-304 aaPF28649SKIP24_C239-266 aaPF01642MM_CoA_mutase280-318 aaPF30350COG1_C316-351 aaPF26547PDZD8_N323-417 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G123890 | PF23065 | PH_SMPa | 60 | 186 | 2.6e-54 | 183.6 |
| TkA04G123890 | PF17095 | CAMSAP_CC1 | 87 | 93 | 3.8 | 8.2 |
| TkA04G123890 | PF00169 | PH | 97 | 184 | 0.0089 | 17.3 |
| TkA04G123890 | PF16746 | BAR_3 | 230 | 304 | 0.00048 | 20.6 |
| TkA04G123890 | PF28649 | SKIP24_C | 239 | 266 | 8.5 | 7.1 |
| TkA04G123890 | PF01642 | MM_CoA_mutase | 280 | 318 | 0.13 | 11.3 |
| TkA04G123890 | PF30350 | COG1_C | 316 | 351 | 0.63 | 11.0 |
| TkA04G123890 | PF26547 | PDZD8_N | 323 | 417 | 1.9e-14 | 54.6 |
| TkA04G123890 | PF10296 | MMM1 | 326 | 415 | 0.0046 | 17.0 |
| TkA04G123890 | PF26544 | Mdm12 | 338 | 385 | 0.0076 | 16.5 |
| TkA04G123890 | PF30350 | COG1_C | 338 | 361 | 0.63 | 11.0 |
| TkA04G123890 | PF01642 | MM_CoA_mutase | 399 | 493 | 0.13 | 11.3 |
| TkA04G123890 | PF16746 | BAR_3 | 422 | 496 | 0.00048 | 20.6 |
| TkA04G123890 | PF26544 | Mdm12 | 430 | 485 | 0.0076 | 16.5 |
| TkA04G123890 | PF30350 | COG1_C | 442 | 491 | 0.63 | 11.0 |
| TkA04G123890 | PF28649 | SKIP24_C | 445 | 515 | 8.5 | 7.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.