RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G123850
Reference: TK1151 Chr: Chr04 Coordinates: 32172383-32174773 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

819 bp · TkA04G123850|TK1151|cDNA

CAAGAAATTAGCTACCGAAACTACCCTCAGATTTTCGAATCAAATCCATTAAAATCAAGGACAAGTCAGGACTTTTTTTTACACTAGACATATCGTACCATCAAGCTTTCTCAATCATATCTCCTTCCAAGCATTCACATACTCCGAGATTACCGTCCTCCATCGCTACAATGGCGTTACAAATTCATCATGTTTCCCGACCGATTCCGCCGTCGTCTTCATTTGGACCACTGTCGTCATGTACGACTAAACAGTTTACC...

CDS

Download CDS FASTA

543 bp · TkA04G123850|TK1151|CDS

ATGGCGTTACAAATTCATCATGTTTCCCGACCGATTCCGCCGTCGTCTTCATTTGGACCACTGTCGTCATGTACGACTAAACAGTTTACCATCGGCAGAGATGTTCGCCAATCCTATGCTTTAACGAAGACGATCAATAATAAAACCAGAAAAAGCTTGAGGTCTTCGGTAAGGGTGAGATCGAGCTTGGAGATGTCCGATCCATCGGTAGTTGTAGGTCAGGTTACTGAGGTTGATAAGGATACGTTTTGGCCAATCGT...

Protein

Download Protein FASTA

180 aa · TkA04G123850|TK1151|PROTEIN

MALQIHHVSRPIPPSSSFGPLSSCTTKQFTIGRDVRQSYALTKTINNKTRKSLRSSVRVRSSLEMSDPSVVVGQVTEVDKDTFWPIVNAAGDKTVVLDMYTQWCGPCKIIAPKFQELAEKNLDVVFLKLDCNQENKPLAKELGIKVVPTFKILKHGKIQKEVTGAKLENIIAAMEEVRSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G123850
TK1151 IDTkA04G123850
OH-1004 IDLXL04_035555
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)100.000
Protein coverage (%)TK1151 86.667 / OH-1004 42.162
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G123850
LocationChr04:32172383-32174773 (-)
DescriptionSimilar to Thioredoxin F-type, chloroplastic
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g16400 Probable thiol-disulfide oxidoreductase involved in the redox regulation of enzymes of both reductive pentose phosphate pathway (Calvin-Benson cycle) and oxidative pentose phosphate pathway. No verified direct reference in this release
At3g02730 Thiol-disulfide oxidoreductase involved in the redox regulation of enzymes of both reductive pentose phosphate pathway (Calvin-Benson cycle) and oxidative pentose phosphate pathway. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0913000 Thiol-disulfide oxidoreductase involved in the redox regulation of enzymes of both reductive pentose phosphate pathway (Calvin-Benson cycle) and oxidative pentose phosphate pathway. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_035555 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009642 response to light intensity Biological Process
GO:0045454 cell redox homeostasis Biological Process
GO:0005829 cytosol Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0009536 plastid Cellular Component
GO:0009570 chloroplast stroma Cellular Component
GO:0008047 enzyme activator activity Molecular Function
GO:0015035 protein-disulfide reductase activity Molecular Function
KEGG gene cross-reference
ath:AT5G16400
dosa:Os01g0913000
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.971
Rank 1 · TkA04G123850 · TK1151
Mitochondrion0.036
Rank 2 · TkA04G123850 · TK1151
Nucleus0.019
Rank 3 · TkA04G123850 · TK1151
Cytoplasm0.012
Rank 4 · TkA04G123850 · TK1151
Cell membrane0.009
Rank 5 · TkA04G123850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00085Thioredoxin75-175 aa
PF13098Thioredoxin_289-172 aa
PF00578AhpC-TSA91-143 aa
PF13905Thioredoxin_892-134 aa
PF08534Redoxin92-134 aa
PF14595Thioredoxin_993-154 aa
PF04756OST3_OST6103-155 aa
PF20207PedC-like104-164 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G123850PF00085Thioredoxin751754.7e-2381.9
TkA04G123850PF13098Thioredoxin_2891728e-0523.6
TkA04G123850PF00578AhpC-TSA911430.00119.7
TkA04G123850PF13905Thioredoxin_8921340.0001223.2
TkA04G123850PF08534Redoxin921340.00517.4
TkA04G123850PF14595Thioredoxin_9931540.01116.3
TkA04G123850PF04756OST3_OST61031550.112.7
TkA04G123850PF20207PedC-like1041640.03914.7
TkA04G123850PF13905Thioredoxin_81331540.0001223.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9XFH9Arabidopsis thalianasp|Q9XFH9|TRXF2_ARATH Thioredoxin F2, chloroplastic76.000%Swiss-ProtMedium
Q9XFH8Arabidopsis thalianasp|Q9XFH8|TRXF1_ARATH Thioredoxin F1, chloroplastic72.100%Swiss-ProtMedium
Q8S091Oryza sativa subsp. japonicasp|Q8S091|TRXF_ORYSJ Thioredoxin F, chloroplastic78.200%Swiss-ProtMedium

JBrowse

View in Genome Browser