Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1303 bp · TkA04G121560|TK1151|cDNA
GTGCAGCCTAAGAAACATACCATTTTTGCAATTTTGTCCCTAAGAAATTAACAAGTTAACGACAAAAAAGAAAAAGAATATCATGTGTATTTTCTTCAGCCATTGCCCATTGTTACTCCACCGCCACTTTATACCAATTGTCCATGCTTTCCAATAATCCAATTTAGATCGTTCAACCCTAACTTTCATCGATCATGGCATAAATATTCTTATTTGTGTGAAAATTCTGATTTTCAATTCGATTTCTTGATCGATCTCAC...
723 bp · TkA04G121560|TK1151|CDS
ATGTCGAAGGAATTCAACGTCCCCCCTGTGATTTTCCCCTCAGGCGGAAACCCCAACACCGGCCCTCAACAACGTCGTCTCCCAACAGCACCGTTTCAGCCTGCGAGATCCGCAAACGCCAGTATCCCTTTTATGTCATTCGATATCGGATCGTCTCCGGCATCCACTTCCTTCTCCACTCCTCAATTCGGAAGCACCATCGGCAGCGGCGGCGGCGGCAGCAGTACGAACTTTGACGACGAGCCGCCTCTCCTGGAAGA...
Protein
Download Protein FASTA240 aa · TkA04G121560|TK1151|PROTEIN
MSKEFNVPPVIFPSGGNPNTGPQQRRLPTAPFQPARSANASIPFMSFDIGSSPASTSFSTPQFGSTIGSGGGGSSTNFDDEPPLLEELGINTKQIWNKTASILNPFRVKADLHEDADLSGPILFIMAFGLFQLLAGKLHFGIIFGWTTVASLFLYVVFNMLAGRNGNLDLYRCLSLIGYCMLPIVILSALSLFVPQGGVLIFAMTGVFVIWATRVCTSLLVELASCGDEHRGLIAHASGH
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G121560 |
|---|---|
| TK1151 ID | TkA04G121560 |
| OH-1004 ID | LXL04_022146 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 87.800 |
| Protein coverage (%) | TK1151 98.750 / OH-1004 94.286Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G121560 |
|---|---|
| Location | Chr04:31575476-31577289 (-) |
| Description | Similar to yipf5: Protein YIPF5 homolog |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0007030 Golgi organization Biological Process GO:0015031 protein transport Biological Process GO:0030070 insulin processing Biological Process GO:0048280 vesicle fusion with Golgi apparatus Biological Process GO:0060628 regulation of ER to Golgi vesicle-mediated transport Biological Process GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005793 endoplasmic reticulum-Golgi intermediate compartment Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005801 cis-Golgi network Cellular Component GO:0005802 trans-Golgi network Cellular Component GO:0030134 COPII-coated ER to Golgi transport vesicle Cellular Component |
| KEGG gene cross-reference | ddi:DDB_G0283541 hsa:285525 mmu:75581 pon:100174636 xtr:493343 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04893Yip1110-233 aaPF09843DUF2070121-216 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G121560 | PF04893 | Yip1 | 110 | 233 | 1.3e-08 | 35.6 |
| TkA04G121560 | PF09843 | DUF2070 | 121 | 216 | 5.2 | 5.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.